(data stored in ACNUC7421 zone)

EMBL: CP000247.PE460

CP000247.PE460       Location/Qualifiers
FT   CDS_pept        495137..496984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0467"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68498"
FT                   /db_xref="GOA:A0A454A1S9"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1S9"
FT                   /protein_id="ABG68498.1"
FT                   /translation="MLNRYPLWKYVMLIVVIVIGLLYALPNLFGEDPAVQITGARGVAA
FT                   SEQTLIQVQKTLQEEKITAKSVALEEGAILARFDSTDTQLRAREALMGVMGDKYVVALN
FT                   LAPATPRWLAAIHAEPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGI
FT                   PYTTVRKENNYGLSITFRDAKARDEAIAYLSKRHPDLVISSQGSNQLRAVMSDARLSEA
FT                   REYAVQQNINILRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEF
FT                   RLVNTNVDQAAAASGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQ
FT                   VNISLDSAGGNIMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQ
FT                   SRLGNSFRITGINNPSEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIEQGLEACL
FT                   AGLLVSILFMIIFYKKFGLIATSALIANLILIVGIMSLLPGATLSMPGIAGIVLTLAVA
FT                   VDANVLINERIKEELSNGRTVQQAIDEGYRGAFSSIFDANITTLIKVIILYAVGTGAIK
FT                   GFAITTGIGVATSMFTAIVGTRAIVNLLYGGKRVKKLSI"
     gtgttaaacc gttatccttt gtggaagtac gtcatgctga tcgtggtgat tgtcatcggt        60
     ctgctgtatg cgcttcccaa cctgtttggt gaggatccgg ctgttcagat cactggtgcg       120
     cgcggagtcg ccgccagtga gcaaacgctg atccaggtcc agaaaacgtt acaagaagaa       180
     aaaataactg ctaagtctgt ggcactggaa gagggcgcta ttcttgcgcg cttcgactcc       240
     actgacaccc agctgcgcgc tcgtgaagca ttaatgggcg ttatgggtga caaatacgtc       300
     gtggcgctta atcttgcccc ggcaacgccg cgctggctgg cagccattca tgctgagccg       360
     atgaagctcg gccttgacct gcgtggcggc gttcacttcc tgatggaagt ggatatggac       420
     accgcgcttg gcaaactcca ggaacaaaat atcgatagcc tgcgcagcga cctgcgtgaa       480
     aagggcatcc cgtataccac cgttcgtaaa gaaaacaact acggcctgag catcactttc       540
     cgcgatgcta aagctcgtga tgaagccatt gcgtatctga gcaagcgcca tccggacctg       600
     gtgattagca gccagggcag caaccagctg cgtgcggtaa tgagcgatgc tcgtctgagt       660
     gaagcgcgtg aatatgcggt gcagcagaac atcaatatcc tgcgtaaccg tgtaaaccaa       720
     cttggcgtgg cggagccggt ggttcagcgt cagggtgctg accgtatcgt tgttgaactg       780
     ccaggtattc aggacactgc gcgtgcgaaa gagattctgg gtgcgacggc aacgctggaa       840
     ttccgtctgg taaacaccaa cgttgatcag gccgctgcgg catccggtcg cgtaccgggc       900
     gactctgaag tgaaacagac ccgcgaaggt cagccggttg tgctgtacaa acgcgtaatt       960
     ctgaccggtg accatatcac cgactccact tccagccagg acgaatacaa ccagccgcag      1020
     gttaacatct cgctcgatag cgcgggtggt aacatcatgt ctaacttcac caaggacaac      1080
     atcggcaaac cgatggcaac tctgtttgtg gagtacaaag acagcggtaa gaaagatgca      1140
     aacggtcgtg cggttctggt gaaacaggaa gaggtgatta acatcgccaa catccagtct      1200
     cgtctgggta acagcttccg tattactggc atcaataacc caagcgaagc gcgtcagctt      1260
     tcactgctgc tgcgtgccgg tgcgttgatc gcgccgattc agattgttga agaacgtacc      1320
     attggcccaa ccctgggtat gcagaacatt gagcaggggc tggaggcttg ccttgccggt      1380
     ctgctggttt ctattctgtt catgatcatc ttctataaga agtttggtct gattgcgacc      1440
     agtgctctga ttgccaactt gatcttgatt gtcggtatta tgtcgctgtt gccaggcgca      1500
     acgctgagta tgccaggtat cgcgggtatc gtcttaaccc ttgcggtagc ggtcgatgcg      1560
     aacgtactga tcaacgaacg tattaaagaa gagttgagca acggacgtac tgttcaacag      1620
     gcaattgatg aaggttatcg tggcgcattc agttccatct tcgatgcgaa catcaccacg      1680
     ctgattaaag tcatcatcct gtatgcagtg ggtaccgggg caattaaagg gttcgcgatt      1740
     actaccggta tcggtgtggc gacgtcgatg tttaccgcga ttgtcggtac gcgtgccatc      1800
     gtaaacctgc tatatggcgg caagcgcgtc aagaagctgt caatctga                   1848
//

If you have problems or comments...

PBIL Back to PBIL home page