(data stored in ACNUC7421 zone)

EMBL: CP000247.PE463

CP000247.PE463       Location/Qualifiers
FT   CDS_pept        complement(498481..499365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0470"
FT                   /product="nucleoside-specific channel-forming protein tsx
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68501"
FT                   /db_xref="GOA:A0A454A1U2"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1U2"
FT                   /protein_id="ABG68501.1"
FT                   /translation="MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSY
FT                   HTRFGPQLRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEP
FT                   RFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSM
FT                   NVYAKYQWQNYGAANENEWDGYRFKVKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSG
FT                   YANNGIKTRTNNSIASSHILALNYDHWHYSVVARYWHNGGQWNDDAELNFGNGNFNVRS
FT                   TGWGGYLVVGYNF"
     atgaaaaaaa cattactggc agccggtgcg gtactggcgc tctcttcgtc ttttactgtc        60
     aacgcagctg aaaacgacaa accgcagtat ctttccgact ggtggcacca gagcgttaac       120
     gttgtcggaa gctatcacac ccgtttcgga ccgcagctcc gcaacgatac ctaccttgag       180
     tacgaagcat tcgctaaaaa agactggttc gacttctatg gttatgcgga tgcgccggta       240
     ttcttcggcg gtaactccga tgcaaaaggt atctggaacc acggttctcc gctgtttatg       300
     gaaatcgaac cgcgtttctc catcgacaag ctgaccaata ctgaccttag ctttggtccg       360
     ttcaaagagt ggtacttcgc gaacaactac atttacgaca tgggtcgtaa taaagatggc       420
     cgccagagca cctggtacat gggtctgggt accgacatcg atactggtct gccgatgagc       480
     ctgtccatga acgtctatgc gaaataccag tggcagaact acggcgcagc gaacgaaaac       540
     gagtgggacg gttaccgttt caaagtgaag tactttgtgc cgattaccga tctgtggggc       600
     ggccagctga gctacatcgg cttcaccaac ttcgactggg gttccgacct gggcgatgac       660
     agcggttatg cgaacaacgg tattaaaaca cgtaccaata actctattgc gtccagccat       720
     attctggcgc tgaattacga tcactggcac tactctgtcg ttgcccgtta ctggcataac       780
     ggtggtcagt ggaatgacga tgcagaactg aacttcggca acggcaactt caacgttcgc       840
     tctaccggct ggggtggtta tctggtagta ggttacaact tctaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page