(data stored in ACNUC7421 zone)

EMBL: CP000247.PE483

CP000247.PE483       Location/Qualifiers
FT   CDS_pept        complement(515274..515888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0490"
FT                   /product="cytochrome O ubiquinol oxidase subunit III"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68519"
FT                   /db_xref="GOA:A0A454A1T2"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1T2"
FT                   /protein_id="ABG68519.1"
FT                   /translation="MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFFLLFSSITYGMAAIAMYKNNKSQVISWLAL
FT                   TWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   IARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM"
     atggcaactg atactttgac gcacgcgact gcccacgcgc acgaacacgg gcaccacgat        60
     gcaggcggaa ccaaaatctt cggattttgg atctacctga tgagcgactg cattctgttc       120
     tctatcttgt ttgctaccta tgccgttctg gtgaacggca ccgcaggtgg gccgacaggt       180
     aaggacattt tcgaactgcc gttcgttctg gttgaaactt tcttcctgtt gttcagctcc       240
     atcacctacg gcatggcggc tatcgccatg tacaaaaaca acaaaagcca ggtgatctcc       300
     tggctggcgt tgacatggtt gtttggtgcc ggatttatcg ggatggaaat ctatgaattc       360
     catcacctga ttgttaacgg catgggtccg gatcgcagcg gcttcctgtc agcattcttt       420
     gcgctggtcg gcacgcacgg tctgcacgtc acttccggtc ttatctggat ggcggtgctg       480
     atggtgcaaa tcgcccgtcg cggcctgacc agcactaacc gtacccgcat catgtgcctg       540
     agcctgttct ggcacttcct ggatgtggtt tggatctgtg tgttcactgt tgtttatctg       600
     atgggggcga tgtaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page