(data stored in ACNUC7421 zone)

EMBL: CP000247.PE494

CP000247.PE494       Location/Qualifiers
FT   CDS_pept        528679..528951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0501"
FT                   /product="DNA-binding protein HU-beta"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68530"
FT                   /db_xref="GOA:A0A454A1W1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1W1"
FT                   /protein_id="ABG68530.1"
FT                   /translation="MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
     gtgaataaat ctcaattgat cgacaagatt gctgcagggg ctgatatctc taaagctgcg        60
     gctggccgtg cgttagatgc tattattgct tccgtaactg aatctctgaa agaaggggat       120
     gatgtagcac tggtaggttt tggtactttt gccgtcaaag agcgtgctgc ccgtactggc       180
     cgcaacccgc agaccggtaa agagatcacc atcgctgctg ctaaagtacc gagcttccgt       240
     gcaggtaaag cactgaaaga cgcggtaaac taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page