(data stored in ACNUC7421 zone)

EMBL: CP000247.PE501

CP000247.PE501       Location/Qualifiers
FT   CDS_pept        535539..536081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0508"
FT                   /product="hypothetical transcriptional regulator protein
FT                   YbaO AsnC familiy"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68537"
FT                   /db_xref="GOA:A0A454A1V9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1V9"
FT                   /protein_id="ABG68537.1"
FT                   /translation="MLKPHRINCRDFTFKIELKEKKILCGRAMLDKIDRKLLALLQQDC
FT                   TLSLQALAEAVNLTTTPCWKRLKRLEDDGILIGKVALLDPEKIGLGLTAFVLIKTQHHS
FT                   SEWYCRFVTVVTEMPEVLGFWRMAGEYDYLMRVQVADMKRYDEFYKRLVNSVPGLSDVT
FT                   SSFAMEQIKYTTSLPIE"
     atgcttaaac cgcacagaat aaattgtcgc gatttcacct ttaaaataga attaaaagag        60
     aaaaaaattc tctgtggaag ggctatgtta gataaaattg accgtaagct gctggccttg       120
     ctacagcagg attgcaccct ctctttgcag gcactggctg aagccgttaa tctgacaacc       180
     accccctgct ggaagcgtct gaaacggctg gaggacgacg gtatccttat cggcaaagtc       240
     gccctgctgg atccggaaaa aataggcctc ggcctgaccg cctttgtgct gataaaaacg       300
     caacatcaca gcagcgaatg gtattgccgc tttgtcacgg tggttaccga aatgccagaa       360
     gtgctggggt tctggcgcat ggctggtgaa tacgattatc tgatgcgcgt ccaggttgcc       420
     gacatgaaac gctacgacga gttttataag cgtctggtaa acagtgtacc ggggctgtcg       480
     gacgtcactt ccagcttcgc gatggaacag attaaataca ccacttcttt acccatcgaa       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page