(data stored in ACNUC7421 zone)

EMBL: CP000247.PE504

CP000247.PE504       Location/Qualifiers
FT   CDS_pept        539838..540176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0511"
FT                   /product="nitrogen regulatory protein P-II 2"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68540"
FT                   /db_xref="GOA:A0A454A1X3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1X3"
FT                   /protein_id="ABG68540.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRT
FT                   GEADEAAL"
     atgaagctgg tgaccgtgat tatcaaacca ttcaaacttg aagacgttcg tgaagcgtta        60
     tcttccattg gtattcaggg cctgaccgtc accgaagtga aaggtttcgg gcgtcagaaa       120
     gggcatgccg agctgtaccg gggggcggaa tacagcgtca acttcctgcc aaaagtaaaa       180
     attgatgtgg cgattgctga tgaccaactc gatgaagtga tcgatatcgt cagcaaagcg       240
     gcttacaccg gaaaaattgg cgacggcaaa atcttcgtcg ctgaattgca acgcgtcatt       300
     cgtattcgta ccggcgaagc cgacgaagcg gcgctgtaa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page