(data stored in ACNUC7421 zone)

EMBL: CP000247.PE507

CP000247.PE507       Location/Qualifiers
FT   CDS_pept        542619..543053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0514"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-terminal part of lipoprotein YbaY"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68543"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1Y2"
FT                   /protein_id="ABG68543.1"
FT                   /translation="MKLVHMASGLAVAIALAACADQSADIQTPAPAANTSISATQQPAI
FT                   QQPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLAQKAVRTEGKQSPFSFVLP
FT                   FNPADVQPNARILLSAAITVNDKLVFITDTVQPVINQWRN"
     atgaaactcg tgcacatggc cagtggttta gcggttgcga ttgcgttggc ggcttgcgca        60
     gatcaaagcg cggatattca gacgccagca ccggctgcaa atacgtctat ttcagcaaca       120
     caacaacctg ctatccagca accgaatgtc tccggtaccg tttggatccg tcagaaagtc       180
     gcactgccgc ctgatgccgt gctgaccgtg acactttctg acgcgtcgtt agccgatgcg       240
     ccgtcgaaag tgctggcgca gaaagcggtg cgtaccgaag gtaaacagtc accattcagc       300
     tttgttctgc catttaaccc ggcagatgtt cagccgaacg cgcgtattct gttgagtgcg       360
     gcgattaccg tgaatgacaa actggtattt attaccgata ccgttcagcc ggtgatcaac       420
     cagtggcgga actaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page