(data stored in ACNUC7421 zone)

EMBL: CP000247.PE512

CP000247.PE512       Location/Qualifiers
FT   CDS_pept        complement(546022..546492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0519"
FT                   /product="putative membrane protein YlaC"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68548"
FT                   /db_xref="GOA:A0A454A1W3"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1W3"
FT                   /protein_id="ABG68548.1"
FT                   /translation="MTEIQRLLTETIESLNTREKRDNKPRFSISFIRKHPGLFIGMYVA
FT                   FFATLAVMLQSETLSGSVWLLVVLFILLNGFFFFDVYPRYRYEDIDVLDFRVCYNGEWY
FT                   NTRFVPAALVEAILNSPRVADVHKEQLQKMIVRKGELSFYDIFTLARAESTS"
     atgaccgaaa tacaacgcct gctgaccgaa acgattgagt ctctgaatac ccgcgaaaaa        60
     cgcgacaaca aaccccgctt tagtatcagt tttatccgta aacatccggg gctgtttatc       120
     ggtatgtacg ttgctttttt tgccaccctg gcggtgatgt tgcagtccga aacgctttca       180
     ggctctgtct ggctactggt tgtattattt atcctgctta atggtttctt ctttttcgat       240
     gtctacccac gctaccgcta tgaagatatc gacgtgctgg atttccgcgt ttgctataac       300
     ggcgaatggt acaacacgcg ctttgtacct gccgcgctag ttgaagccat cctgaactct       360
     ccgcgtgtcg cggatgttca taaagaacaa ctgcaaaaaa tgatcgtccg taaaggtgaa       420
     ctatcttttt acgatatttt taccctcgct cgcgccgaat caacatctta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page