(data stored in ACNUC7421 zone)

EMBL: CP000247.PE517

CP000247.PE517       Location/Qualifiers
FT   CDS_pept        complement(551668..552492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0524"
FT                   /product="acriflavin resistance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68553"
FT                   /db_xref="GOA:A0A454A1Z3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1Z3"
FT                   /protein_id="ABG68553.1"
FT                   /translation="MTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETAR
FT                   INLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDFLRLK
FT                   QELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHT
FT                   LLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVASQAIGD
FT                   KWLVTEGLKAGDRVVISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS"
     ttgacggtga atcgttatca gaaattgctc ggtactcagt acatcagtaa gcaagagtac        60
     gatcaggctc tggctgatgc gcaacaggcg aatgctgcgg taactgcggc gaaagctgcc       120
     gttgaaactg cgcgaatcaa tctggcttac accaaagtca cctctccgat tagtggtcgc       180
     attggtaagt caaacgtgac ggaaggcgca ttggtacaga acggtcaggc gactgcgctg       240
     gcaaccgtgc agcaacttga tccgatctac gttgatgtga cccagtccag caacgacttc       300
     ctgcgcctga aacaggaact ggcgaatggc acgctgaaac aagagaacgg caaagccaaa       360
     gtgtcgctga tcaccagtga cggcattaag ttcccgcagg acggtacgct ggaattctct       420
     gacgttaccg ttgatcagac cactgggtct atcaccctac gcgctatctt cccgaacccg       480
     gatcacactc tgctgccggg tatgttcgtg cgcgcacgtc tggaagaagg gcttaatcca       540
     aacgctattt tagtcccgca acagggcgta acccgtacgc cgcgtggcga tgccaccgta       600
     ctggtggttg gcgcggatga caaagtggaa acccgtccga tcgttgcaag ccaggctatt       660
     ggcgataagt ggctggtgac agaaggtctg aaagcaggcg atcgcgtagt aataagtggg       720
     ctgcagaaag tgcgtcctgg tgtccaggta aaagcacaag aagttaccgc tgataataac       780
     cagcaagccg caagcggtgc tcagcctgaa cagtccaagt cttaa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page