(data stored in ACNUC7421 zone)

EMBL: CP000247.PE526

CP000247.PE526       Location/Qualifiers
FT   CDS_pept        561646..562251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0533"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68562"
FT                   /db_xref="GOA:Q0TKG9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKG9"
FT                   /protein_id="ABG68562.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   TLTRAMSEIGHCADCRTFTEQEVCNICSNPRRKENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQ
FT                   YDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF"
     atgcaaacca gcccgctgtt aacacagctt atggaagcac tgcgctgcct gccgggcgtt        60
     ggcccgaagt cggcgcagcg tatggcgttc acgctgcttc agcgcgatcg tagcggcggg       120
     atgcgtctgg cgcagacgct cacccgggcg atgtcggaaa tcggccactg cgccgattgc       180
     cgcaccttca ccgaacagga agtctgtaac atctgttcga atccgcgtcg taaggaaaac       240
     ggtcaaatct gcgtggtgga gagtccggcg gacatctacg ccattgagca gacggggcag       300
     ttttcaggcc gttattttgt gttgatgggg cacctgtcac cgctggacgg catcggtccg       360
     gatgatatcg ggcttgatcg tctggaacag cgtctggcag aggaaaaaat cactgaagtg       420
     atcctcgcca ccaaccccac ggttgaaggt gaagctaccg ctaactacat tgccgagctt       480
     tgtgcgcaat atgacgtgga agccagccga atcgctcatg gcgtaccggt tggcggcgaa       540
     ctggaaatgg tcgatggcac cacgctgtca cactcccttg ccgggcgtca taagattcgt       600
     ttttaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page