(data stored in ACNUC7421 zone)

EMBL: CP000247.PE538

CP000247.PE538       Location/Qualifiers
FT   CDS_pept        complement(575732..576526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0545"
FT                   /product="hypothetical protein YbaP"
FT                   /note="putative ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68574"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1V2"
FT                   /protein_id="ABG68574.1"
FT                   /translation="MDLLYRVKTLWAALRGNHYTWPAIDISLPGNRHFHLIGSIHMGSH
FT                   DMAPLPTRLLKKLKNADALIVEADVSTSDTPFANLPACEALEERISEDQLQNLQHISQE
FT                   MGISPSLFSTQPLWQIAMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAEN
FT                   QIAMLLQLPDKGLALLDDTLTHWHTNARLLQQMMSWWLNAPPQNNEITLPNTFSQSLYD
FT                   VLMHQRNLAWRDKLRAMPPGRYVVAVGALHLYGEGNLPQMLR"
     atggatctgt tgtaccgggt aaaaacgctt tgggccgcgc tgcgcggtaa tcattacacc        60
     tggcctgcta tcgatatctc tcttcccggc aatcgccatt ttcatctgat cggcagtatt       120
     catatgggta gccacgatat ggctcccctg cccacccgtt tgctcaaaaa gctcaaaaac       180
     gccgatgcgc tgatcgtcga ggcggatgtt tccaccagcg atacgccttt tgccaatttg       240
     cctgcctgcg aggccctgga agagcgcatt agcgaggacc aactccaaaa cctgcagcac       300
     attagccagg agatgggcat ttctccgtcg ctcttttcta cccaaccgct gtggcaaatc       360
     gcgatggttc ttcaggcgac gcaggcgcaa aaactggggc tgcgggcaga atacggtatc       420
     gattaccagc tattgcaggc ggctaagcaa caacataaac ccgtgattga actggaaggg       480
     gctgaaaacc agattgccat gttgctccag ctccctgaca aaggactggc gctgctggac       540
     gatacgctga cccactggca caccaacgca cggttgctgc aacaaatgat gagctggtgg       600
     ctgaatgcac cgccgcaaaa taatgaaata acgttgccca atacgttcag tcagtcgctg       660
     tacgatgtgc tgatgcatca gcgaaatctc gcctggcggg ataaattacg cgccatgccg       720
     ccggggcgat atgtggtcgc ggttggtgca ctacacctgt atggagaagg gaatttgccg       780
     cagatgttgc gctaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page