(data stored in ACNUC7421 zone)

EMBL: CP000247.PE546

CP000247.PE546       Location/Qualifiers
FT   CDS_pept        complement(582923..584146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A209"
FT                   /protein_id="ABG68582.1"
FT                   /translation="MFSPFRKPEVRLLKNTAAGVIFSVKSGKGFLRQCVIYDPHSHGLI
FT                   HSLCWQDVPLIRFWSEAGCPTCAKFVYSGFTEDEQGAARFLSALENWNRPWSGITDAFA
FT                   ALTPLFTCMADGYYLLEDRELYPTDGNGHFFWAATDHSSSNPATVAVWDPEYCSFSDTA
FT                   PCFLLPGQPPSHFNPERATFYRDKPDARALAWYLPDSYLCVLLDGHHKATAAALEGRPL
FT                   KTLVLSTATHFNDEQQTLVFPGGECLHKTELQYHIPKLTACKTLPPSAWESFGPDKHIS
FT                   PSETWSEELKQSVSRYPSLDQAWQIVEAGNLSETRIKSMIQQGLGEDEKADIILQALFS
FT                   THSPLFIDFARFVISHPAYAIYRPLTFRLMAQNRTPQADAFFLDFAINDDGERPELTKI
FT                   MDDYFRKP"
     atgttttccc cctttcgaaa acctgaagta cgtctgctga aaaataccgc tgcgggcgtc        60
     attttttcgg tgaagtccgg gaaaggattt ctgcgtcaat gtgtgattta cgatccgcac       120
     tcgcacggtc ttatccattc gctctgctgg caggatgtcc cgttaatacg tttctggtcc       180
     gaggctggat gccctacatg tgcgaaattt gtctacagcg gttttacgga ggatgaacag       240
     ggagccgccc ggtttttgtc tgctctcgaa aactggaatc gcccgtggtc tggcataacg       300
     gacgcttttg ccgcgctgac accgctgttc acatgcatgg ctgatggtta ttatttgctg       360
     gaagatcgtg aactttaccc gacggatggc aacgggcatt tcttttgggc ggcaacggac       420
     catagttcca gtaatccggc aaccgttgcc gtctgggatc ctgaatattg ctctttcagt       480
     gacaccgcgc cctgctttct tctacccggc cagccgccat cacattttaa tcctgagcgt       540
     gcgacgtttt atcgcgataa accggacgcc cgcgctctgg cctggtatct ccctgattcc       600
     tatctctgcg ttctgctcga cggacaccat aaggctactg ccgccgcgct ggaagggcga       660
     ccgctcaaaa cactggtgct cagcacggca acccatttta atgatgagca acaaaccctg       720
     gtatttcctg gcggggaatg tctgcacaaa acagagctgc aataccacat accaaaactc       780
     accgcgtgca aaacattacc gcccagcgca tgggagagtt tcggccctga taagcacatc       840
     agcccatccg aaacctggtc agaagagtta aagcagagcg tcagtcggta cccctcgctg       900
     gatcaagcct ggcaaattgt tgaggccggg aatttgagcg aaactcgtat taagagcatg       960
     atccaacaag gtttggggga ggatgaaaag gctgatatta ttttgcaggc gctgttttcc      1020
     acacactcgc cgctttttat tgactttgcc cgattcgtta tcagccatcc ggcatacgcc      1080
     atttatcgcc ccctcacctt ccggttgatg gcgcaaaacc gaacgccgca agcagatgct      1140
     ttttttctgg attttgccat caatgatgac ggggaacgtc cggagttgac gaaaataatg      1200
     gacgactatt ttcgcaagcc ttaa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page