(data stored in ACNUC7421 zone)

EMBL: CP000247.PE547

CP000247.PE547       Location/Qualifiers
FT   CDS_pept        complement(584265..584723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0554"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68583"
FT                   /db_xref="GOA:A0A454A212"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A212"
FT                   /protein_id="ABG68583.1"
FT                   /translation="MMELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLV
FT                   VWLVPLGWEWQGVMFAILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLE
FT                   SPLVNGRGHMRVGDSSWPVSASEDLSAGTHVEVIAIEGITLIIRAVIA"
     atgatggagt taatggtcgt tcatccacat attttctggc tcagtctcgg cgggttgctg        60
     ctggcagccg agatgttggg cggaaatggt tatctgttgt ggagcggcgt ggcagcggtg       120
     attaccggcc tggtggtctg gctggtgccg ctgggttggg agtggcaagg ggtgatgttt       180
     gccattctga cactgctcgc cgcctggttg tggtggaaat ggctgtcgcg gcgggtgcgc       240
     gaacaaaagc acagcgacag tcatttaaac cagcgcgggc agcagcttat tggccgacgt       300
     tttgtgctgg aatctccgct ggtcaacggg cgcggtcata tgcgcgtcgg tgacagttca       360
     tggcctgtca gcgccagcga ggatctcagt gcaggtacgc atgttgaggt gattgcgata       420
     gaagggataa cgctgattat ccgtgcggtc atcgcctga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page