(data stored in ACNUC7421 zone)

EMBL: CP000247.PE550

CP000247.PE550       Location/Qualifiers
FT   CDS_pept        586447..587226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0557"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68586"
FT                   /db_xref="GOA:A0A454A1Y8"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1Y8"
FT                   /protein_id="ABG68586.1"
FT                   /translation="MNSHNITNESLALALMLVVVAILISHKEKLALEKDILWSVGRAII
FT                   QLIIVGYVLKYIFSVDDASLTLLMVLFICFNAAWNAQKRSKYIAKAFISSFIAITVGAG
FT                   ITLAVLILSGSIEFIPMQVIPIAGMIAGNAMVAVGLCYNNLGQRVISEQQQIQEKLSLG
FT                   ATPKQASAILIRDSIRAALIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVTQLKKK"
     atgaactcgc ataatattac taacgaatca ttggcactgg cattaatgct ggtggtggtg        60
     gcaatcttaa ttagccataa agaaaaactg gcgctggaga aagatattct ctggagcgtc       120
     gggcgcgcga taattcagct gattattgtc ggctatgtgc tgaagtatat tttcagcgtg       180
     gatgatgcca gcctgacatt attgatggtg ttatttatct gctttaatgc ggcgtggaac       240
     gcgcaaaaac gcagtaaata tattgctaaa gcttttatct catcgtttat tgccattacg       300
     gtcggggcgg gaattactct ggcggtgctg attttatcgg gatcgattga gtttatcccg       360
     atgcaggtga tccctatcgc cgggatgata gccggtaacg ccatggtagc ggtggggttg       420
     tgttacaaca atttagggca acgggttatt agcgaacagc aacagattca ggagaaactg       480
     agtcttggcg cgacgccgaa acaggcttca gcgatattga ttcgcgacag tattcgcgcg       540
     gctttaattc cgacggtcga ttcagcaaaa acggttggct tagtgagttt accaggaatg       600
     atgtccgggc tgatatttgc cgggattgat ccggtgaagg cgattaaata tcagattatg       660
     gtgaccttta tgctgctctc aactgccagc ctgtcgacca ttattgcctg ctatttaacc       720
     tatcgtaaat tttataattc gcgccaccaa ttggtggtga cgcaattgaa gaagaaatga       780
//

If you have problems or comments...

PBIL Back to PBIL home page