(data stored in ACNUC7421 zone)

EMBL: CP000247.PE567

CP000247.PE567       Location/Qualifiers
FT   CDS_pept        604592..605737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0574"
FT                   /product="glycerate kinase 1"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68603"
FT                   /db_xref="GOA:A0A454A230"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A230"
FT                   /protein_id="ABG68603.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTIFPDAHYICLPIADGG
FT                   EGTVDAMVAATGGNIVTLEVCGPMGETVNAFYGLTGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNGIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQVLAA
FT                   NGGNLARVASIEMDECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQLTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLNAVNLAQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
     atgaaaattg tcattgcgcc agactcgttt aaagagagtt taagtgcaga aaaatgttgt        60
     caggcaatta aagccgggtt ttcgaccata tttcccgatg cgcactatat ctgtttgccg       120
     atagcggatg gcggcgaagg gacggtggat gcgatggtcg ccgcgacggg cggcaacatc       180
     gtgacgcttg aagtctgcgg gccgatgggc gaaacagtga atgcttttta tggccttacc       240
     ggcgacggga aaacggcggt gattgagatg gcggcggcaa gcggcctgat gctggtcgcg       300
     cctgaaaagc gtaatccgtt gctggcgtca agttttggca ccggagagct gattcgtcat       360
     gcgctggata acggcattcg ccatattatt ctcggcattg gcggcagtgc gacggtcgac       420
     ggcggtatgg gcatggcgca ggcgctcggt gtgcgtttcc ttgatgctga cggtcaggtg       480
     ctggcggcta acggcggcaa tttagcgcgc gtggcaagca ttgagatgga tgaatgcgat       540
     ccgcgtctgg cgaactgcca tattgaagta gcatgtgatg ttgataaccc gctggtaggg       600
     gcacgcggcg cggcggcggt gtttggtccg caaaaagggg caacgccgga aatggtcgaa       660
     gaactggaac aggggctgca aaattacgcc cgtgttttac aacagctaac tgaaatcaac       720
     gtctgccaga tggcgggtgg tggcgcggcg ggcggtatgg gcattgcggc ggcggtattc       780
     ctcaatgcgg atattaaacc gggtattgag attgtgttga atgcggtcaa tcttgcgcag       840
     gcagtgcagg gtgcagcact ggtgatcacc ggggaagggc gcatcgactc gcaaacggca       900
     ggcggtaaag cgccgctggg tgtggcatcg gtggcgaagc agtttaatgt cccggtgatt       960
     gggattgctg gcgtattggg tgatggcgtg gaagtggtgc accagtacgg cattgatgcg      1020
     gtattcagca ttttgccacg tctggctcct ttagccgaag tgctcgccag cggtgaaacc      1080
     aatctcttca acagtgcgcg aaatattgcc tgcgccatta aaataggtca gggaattaaa      1140
     aactga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page