(data stored in ACNUC7421 zone)

EMBL: CP000247.PE571

CP000247.PE571       Location/Qualifiers
FT   CDS_pept        609285..610952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0578"
FT                   /product="FdrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68607"
FT                   /db_xref="GOA:A0A454A215"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A215"
FT                   /protein_id="ABG68607.1"
FT                   /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKAL
FT                   LDTTGFWHDDFNNATPNDICVAIRSEAADAGIAQAVMQQLEEALKQLAQGSGSSQALTQ
FT                   VRRWDSACQKLPDANLALISVAGEYAAELANQALDRNLNVMMFSDNVTLEDEIQLKTRA
FT                   REKGLLVMGPDCGTSMIAATPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITH
FT                   AIGLGGRDLSREVGGISALTALEMLSADEKSEVLAFVSKPPAETVRLKIVNAMKATGKP
FT                   TVALFLGYTPAVARDENVWFASSLDEAARLACLLSRVTARRNAIAPVSSGFICGLYTGG
FT                   TLAAEAAGLLAGHLGVEADDTHQHGMMLDADGHQILDLGDDFYTVGRPHPMIDPTLRNL
FT                   LIADLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARSDNQPLYAIATVTGTE
FT                   RDPQCRSQQIATLEDAGIAVVSSLPEATLLAAALIHPLSPATQQHTPSLLENVAVINIG
FT                   LRSFALELQSASKPVVHYQWSPIAGGNKKLARLLERLQ"
     atgatccacg cctttattaa aaaagggtgt tttcaggatt cggtcagttt aatgattatt        60
     tcacgaaaac tcagcgaatc agaaaatgtt gatgatgttt ccgtaatgat gggtacgccc       120
     gccaataaag cgttattaga tactacaggt ttctggcatg acgattttaa taacgccacg       180
     ccgaacgata tttgcgtggc aattcgtagc gaagcggcgg atgcggggat cgcgcaggcg       240
     gttatgcagc agcttgaaga ggcgctaaaa caactggcgc agggttcagg cagcagccag       300
     gcgttgacgc aggtgcgtcg ctgggacagt gcctgtcaga aattacccga tgccaatctg       360
     gcgctgattt cagtggctgg tgagtatgcg gcggagctgg cgaaccaggc gctggatcgc       420
     aacctcaacg tgatgatgtt ttccgataac gtcacgctgg aagatgaaat ccaacttaaa       480
     acccgcgcgc gggaaaaagg cttgctggtg atggggccag actgcggtac gtcgatgatt       540
     gccgccacgc cgctggcttt tgctaacgtg atgccggaag gcaacattgg cgtcataggc       600
     gcttccggta ccgggattca ggagctgtgc tcacagattg cgctggcagg ggagggaatt       660
     actcacgcga ttggtcttgg cgggcgcgat ctcagccgtg aagtgggcgg catcagtgcg       720
     ctaacggcgc tggaaatgct cagtgcagac gagaaaagcg aagtgctggc atttgtttca       780
     aaaccacctg ccgaaactgt gcgtctgaaa attgttaatg ccatgaaagc aactggcaaa       840
     ccgacggtgg cgctgttttt aggttatacc ccggcggtgg cccgcgacga gaatgtctgg       900
     tttgcctcct cgctggatga ggccgctcgt ctggcttgtc tgctttcacg cgtcactgcg       960
     cgacgtaacg cgatagcgcc tgtcagcagc ggatttattt gcggtttgta taccggcggt      1020
     acgctggctg ctgaagcggc gggattactt gccggacacc ttggcgtgga agccgacgat      1080
     acccatcaac atggcatgat gctggacgcc gacggacatc agatcctcga cctgggcgat      1140
     gatttttaca ccgtcgggcg tccccatccg atgatcgacc cgaccttacg caacctgtta      1200
     attgccgatc tcggcgctaa accgcaagtg cgcgtgttgc tgcttgatgt cgtgattggc      1260
     ttcggtgcga ccgccgatcc tgccgcctcg ctggtgagcg cctggcaaaa agcctgtgcc      1320
     gcgcgttcag acaatcaacc actgtatgcc attgccacgg tgacaggcac tgaacgtgac      1380
     ccgcaatgcc gctcgcagca aatcgccacg ctggaagatg cggggatcgc ggtagtgagt      1440
     tcgctgccgg aagccacctt gctggcggcg gcgttaattc atccgctctc gcctgccaca      1500
     cagcaacaca caccgtcatt actggaaaac gtcgccgtga ttaacatcgg attacgcagc      1560
     tttgcgctgg agctacaaag cgccagcaaa ccggttgtgc attaccaatg gtcgccaatc      1620
     gccggcggca ataaaaaact ggctcgttta ttagaacgtt tgcaataa                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page