(data stored in ACNUC7421 zone)

EMBL: CP000247.PE58

CP000247.PE58        Location/Qualifiers
FT   CDS_pept        59469..60284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0058"
FT                   /product="DnaJ-like protein DjlA"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68098"
FT                   /db_xref="GOA:A0A454A0W5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0W5"
FT                   /protein_id="ABG68098.1"
FT                   /translation="MQYWGKIIGVTVALIMGGGFWGVVLGLLIGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVG
FT                   KSDNYPLREKMRQFRSVCFGRFDLIRMFVEIQIQAAFADGSLHPNERAVLYVIAEELGI
FT                   SRAQFDQFLRMMQGGAQFGGGYQQQSGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIK
FT                   RAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK"
     atgcagtatt ggggaaaaat cattggcgtg accgtggcct taataatggg cggcggcttt        60
     tggggcgtag tattgggcct gttaattggc catatgtttg ataaagcccg tagccgtaaa       120
     atggcgtggt tcgccaacca gcgtgagcgt caggcgctgt tttttgccac cacttttgaa       180
     gtgatggggc atttaaccaa atccaaaggt cgcgtcacgg aagctgatat tcatatcgcc       240
     agccagttga tggaccgaat gaaccttcat ggcgcttccc gtactgcggc gcaaaatgcg       300
     ttccgggtgg gaaaatcaga caattacccg ctgcgcgaaa agatgcgcca gtttcgcagt       360
     gtctgctttg gtcgttttga cttaattcgt atgtttgtgg agatccagat tcaggcggcg       420
     tttgctgatg gttcactgca cccgaatgaa cgggcggtgc tgtatgtcat tgctgaagaa       480
     ttagggatct cccgcgctca gtttgaccag tttttgcgca tgatgcaggg cggtgcacag       540
     tttggcggcg gttatcagca gcaatctggc ggtggtaact ggcagcaagc gcagcgtggc       600
     ccgacgctgg aagatgcctg taatgtgctg ggcgtgaagc cgacggatga tgcgaccacc       660
     atcaaacgtg cctaccgtaa gctgatgagt gaacaccatc ccgataagtt ggtggcgaaa       720
     ggtttgccgc cagagatgat ggagatggcg aagcagaaag cgcaggaaat tcagcaggcc       780
     tatgagctga taaagcagca gaaagggttt aaataa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page