(data stored in ACNUC7421 zone)

EMBL: CP000247.PE59

CP000247.PE59        Location/Qualifiers
FT   CDS_pept        complement(60402..61061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0059"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68099"
FT                   /db_xref="GOA:A0A454A0W0"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0W0"
FT                   /protein_id="ABG68099.1"
FT                   /translation="MGMENYNPPQEPWLVILYQDDHIMVVNKPSGLLSVPGRLEEHKDS
FT                   VMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHP
FT                   SPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYEVVEYAADNTARVVLKPITGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEARAMAPRLLLHAEMLTITHPAYGNSMTFKAPADF"
     atggggatgg aaaactacaa tccaccgcag gaaccctggt tggttatcct gtatcaggat        60
     gaccatatta tggtggtcaa caagccgagc ggtttgttgt ctgtgccggg tcgtctggaa       120
     gagcacaaag acagcgtgat gacgcgcatt cagcgtgatt atccgcaggc agaatcggtg       180
     catcgtctgg atatggctac cagcggcgtg attgtagtgg cgctgaccaa agccgcggag       240
     cgggagttaa aacgccagtt ccgcgagcgc gagccgaaaa aacagtatgt ggcccgcgtc       300
     tgggggcatc catcccctgc ggaaggtctg gtggatctgc cgctgatttg cgactggcca       360
     aaccgcccga aacagaaagt ctgttacgaa acaggtaaac ctgcgcagac ggagtatgaa       420
     gtggtggaat atgcggcgga taacacggca agagtggtgt taaaaccgat taccgggcgt       480
     tcgcatcagc tgcgtgtgca tatgctggcg ctgggtcatc cgattctcgg cgatcgtttt       540
     tatgcatcac cagaagcgag agcaatggca ccgcgtttgt tgctacatgc agagatgctg       600
     acgattaccc atccggcgta tggcaatagt atgacattta aagcaccagc ggatttttaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page