(data stored in ACNUC7421 zone)

EMBL: CP000247.PE597

CP000247.PE597       Location/Qualifiers
FT   CDS_pept        634873..636096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0605"
FT                   /product="putative copper efflux system protein CusB
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68633"
FT                   /db_xref="GOA:A0A454A253"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A253"
FT                   /protein_id="ABG68633.1"
FT                   /translation="MKKIALIIGSMIAGGIISAAGFTWFAKEEPPAEKTSTAERKVLFW
FT                   YDPMYPNTRFDKPGKSPFMDMDLVPKYADEESSASGVRIDPTQTQNLGVKTATVTRGPL
FT                   TFSQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGAPLLDLTIPDWVEAQS
FT                   EYLLLRETGGTATQTEGILERLRLAGMPEADIRSLIATQKIQTRFTLKAPIDGVITAFD
FT                   LRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKW
FT                   TLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGNEQR
FT                   VITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMR
FT                   SESATHAH"
     atgaaaaaaa tcgcgcttat tatcggcagc atgatcgcgg gcggtattat ttctgcggca        60
     ggttttacct ggtttgcaaa ggaggaaccg cccgcagaaa aaacgtcgac cgcagaacgt       120
     aaagtcttat tctggtacga cccgatgtat cccaatacgc ggttcgataa accagggaaa       180
     tcgccgttta tggatatgga tctggtgccg aaatatgccg atgaagagag ttctgcgtct       240
     ggtgtgcgca ttgacccgac tcagacgcag aatctggggg tgaaaacggc gaccgtcacg       300
     cgcgggccgc tgactttttc ccagagtttc ccggcgaatg tcagttacaa cgagtatcag       360
     tatgccattg tgcaggcccg cgccgccggg tttatcgaca aggtgtatcc gcttaccgtg       420
     ggcgataaag tgcaaaaggg cgcgccgctt ctcgacctga ccattcccga ctgggtggaa       480
     gcgcagagtg agtatttact gctgcgcgaa accggcggta cggcgaccca gactgaaggc       540
     attcttgagc gactgcgact ggcgggaatg ccggaggctg atattcgcag cctgatcgcc       600
     acgcaaaaaa tccagactcg ctttacgctc aaagcgccca ttgatggcgt gatcaccgcg       660
     tttgatctgc gcgcgggaat gaatatcgcc aaagataacg tggtcgcgaa aattcagggt       720
     atggacccgg tgtgggtcac tgctgcgatc ccggagtcca tcgcctggct ggtgaaagat       780
     gcctcgcagt ttacgctcac cgttccggcg cgacctgata aaacactcac catccgcaaa       840
     tggacgctgc tacctggcgt ggatgctgcg acccgcacgc tgcaactgcg tctggaagtc       900
     gacaacgccg acgaggcgct aaaaccgggc atgaacgcct ggttgcaact caataccgcc       960
     agcgaaccga tgctgctcat tccgtcacag gcgctgattg ataccggcaa cgaacagcgg      1020
     gtgattaccg ttgatgctga cgggcgcttt gtaccgaaac gcgttgccgt tttccaggca      1080
     tcgcaaggcg tcaccgcgtt acgctctggt ctggcggaag gtgaaaaggt ggtttccagc      1140
     ggcctgttcc tgattgattc tgaagccaat atttctggcg cactggagcg gatgcgctct      1200
     gaaagtgcta cccatgcgca ttga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page