(data stored in ACNUC7421 zone)

EMBL: CP000247.PE6

CP000247.PE6         Location/Qualifiers
FT   CDS_pept        5243..5530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0006"
FT                   /product="putative periplasmic protein YaaX"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68048"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0T7"
FT                   /protein_id="ABG68048.1"
FT                   /translation="MQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDG
FT                   GHWRDHGWWKQHYEWRGNRWHPHGPPSSPRHNKHNDHRGDHRPGPDKHHR"
     atgcaatcta tcgtactcgc actttccctg gttctggtcg ctcccatggc agcgcaggct        60
     gcggaaatta cgctagtccc gtcagtaaaa ttacagatag gcgatcgtga taatcgtggc       120
     tattactggg atggcggtca ttggcgcgac cacggctggt ggaaacaaca ttatgaatgg       180
     cgaggcaatc gctggcaccc acatggaccg ccgtcatcgc cgcgccataa caagcacaat       240
     gatcatcgtg gcgatcatcg tccggggcct gacaaacatc atcgctaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page