(data stored in ACNUC7421 zone)

EMBL: CP000247.PE60

CP000247.PE60        Location/Qualifiers
FT   CDS_pept        complement(61073..63979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0060"
FT                   /product="RNA polymerase associated protein"
FT                   /note="ATP-dependent helicase HepA"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68100"
FT                   /db_xref="GOA:Q0TLT1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TLT1"
FT                   /protein_id="ABG68100.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAVDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITSHDGWQMQVEEVKEENGLLTYIGTRLDTEESGVALREVFLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKYSSEQFRMPYSGLRGQRTSLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYAEAQHDAYNPFDTEQLVICSLDFARRSKQRLEHLCEAEWDLLVVDE
FT                   AHHLVWSEDAPSREYQAIEQLAEHVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFA
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNDELNMLGEMIGEQDIEPLLQAANSDSEDAQSA
FT                   RQELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIKLPLPTQYQTAIKVSGIMGARK
FT                   SAEDRARDMLYPERIYQEFEGDNATWWNFDPRVEWLMGYLTSHRSQKVLVICAKAATAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   HMVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRTIYDSVYNDLINYLASPDETEGFDDLIKNCREQHEALKAQLEQGRDRLLEIHSN
FT                   GGEKAQALAESIEEQDDDTNLIAFAMNLFDIIGINQDDRGDNMIVLTPSDHMLVPDFPG
FT                   LSEDGITITFDREVALAREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLVELIYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLNAVNRH
FT                   TGSKLVNAVQQDVHAILQLGEAQIEKSARALIDAARNEADEKLSAELSRLEALRAVNPN
FT                   IRDDELTAIESNRQQVMESLDQAGWRLDALRLIVVTHQ"
     atgcctttta cacttggtca acgctggatc agcgatacag aaagcgaatt gggacttgga        60
     accgttgtcg cggtggatgc gcgaactgtc actttacttt tcccatctac tggtgaaaac       120
     cgtctgtacg cacgcagtga ttcccccgtg acccgcgtga tgttcaaccc tggtgatacc       180
     attaccagcc atgacggctg gcagatgcaa gtcgaagaag taaaagaaga aaatggcttg       240
     ctgacctata tcggtactcg ccttgatact gaagagtccg gcgtagccct gcgtgaagtt       300
     ttccttgata gcaaactggt gttcagcaaa ccgcaggacc gtctgtttgc cgggcagatt       360
     gaccgtatgg accgctttgc gctgcgttat cgcgcgcgta agtattccag cgaacagttc       420
     cgtatgccgt acagcggcct gcgcggtcag cgtaccagcc tgatcccgca ccagctcaac       480
     atcgctcatg atgttggtcg ccgccacgcg ccgcgcgtcc tgctggctga cgaagtgggt       540
     ttagggaaaa ccattgaagc cgggatgatc ctgcatcagc aactgctctc tggcgctgct       600
     gaacgtgtgc tgattatcgt cccggaaacc ttacagcatc agtggctggt agaaatgctg       660
     cgccgtttca acctgcgctt tgctctgttt gatgatgagc gttatgccga agctcagcac       720
     gatgcttaca acccgttcga caccgaacag ctggtgattt gctcgctgga ttttgcccgt       780
     cgtagcaaac agcgtctgga acatctctgt gaagccgagt gggacctgct ggtggtcgat       840
     gaagcgcatc acctggtgtg gagcgaagat gcgccgagcc gtgaatatca ggccattgaa       900
     caactggcag agcacgtgcc cggcgttctg ctgctgaccg caaccccgga acaactgggg       960
     atggaaagcc acttcgcccg tctgcgtctg ctggacccga accgtttcca cgattttgcg      1020
     caattcgttg aagagcagaa aaattatcgt ccggttgcgg acgccgttgc catgctgctg      1080
     gctggtaaca aactcagcaa tgacgaactg aacatgctcg gtgagatgat cggcgagcag      1140
     gatatcgagc cgctgttgca agcagcaaac agcgacagcg aagatgccca gagcgcccgt      1200
     caggaactgg tttcgatgct gatggatcgc cacggtacca gccgcgtgct gttccgtaac      1260
     acccgtaacg gtgtgaaagg cttcccgaaa cgcgagctgc acactattaa gctgccactg      1320
     ccgacgcagt atcagaccgc tattaaagtc tccggcatta tgggcgcacg taaaagtgcg      1380
     gaagatcgcg ctcgcgatat gctctatccg gagcgtattt atcaggaatt tgaaggcgat      1440
     aacgccacct ggtggaactt cgatccgcgc gttgaatggc tgatgggcta cctgaccagc      1500
     catcgctctc agaaagtgct ggtgatctgc gccaaagcgg ccactgcgct gcaactggag      1560
     caggtactgc gcgaacgtga aggtattcgc gccgcggtgt tccacgaagg catgtcgatt      1620
     atcgaacgtg accgcgctgc cgcctggttt gccgaagaag acaccggcgc acaggtactg      1680
     ctgtgctcgg aaatcggttc tgaaggacgt aacttccagt tcgccagcca catggtgatg      1740
     tttgacctgc cattcaaccc ggatctgctg gagcagcgta ttggtcgtct ggatcgtatc      1800
     ggtcaggcgc acgatattca gatccatgtg ccttatctgg aaaaaacggc tcagtcggtg      1860
     ctggtgcgct ggtatcacga aggtctggat gcattcgagc acacctgccc gaccggacgc      1920
     actatctacg atagcgtgta caacgatttg attaactatc tggcctcgcc ggatgagacc      1980
     gaaggctttg acgatctgat caaaaactgc cgcgagcagc atgaagcgct gaaagcacaa      2040
     ctggaacagg gccgtgaccg cctgctggaa atccattcca acggtggcga aaaagcccag      2100
     gcactggcag aaagcattga agagcaggat gacgatacca acctgatcgc cttcgccatg      2160
     aacctgttcg atattatcgg tatcaatcag gacgatcgcg gcgacaacat gatcgtgctg      2220
     acgccgtccg atcatatgct ggtgccggac ttccctggcc tgtcggaaga tggcatcacc      2280
     atcaccttcg accgtgaagt ggcgctggcg cgtgaagatg cacagtttat tacctgggag      2340
     catccgctga tccgcaacgg tctggatctg atcctttctg gcgataccgg tagcagcacg      2400
     atttcactgt tgaaaaacaa agcgttgccg gtaggtacgc tgttggtgga actgatttat      2460
     gtggttgaag cccaggctcc gaagcagttg cagctcaacc gcttcctgcc accgacgccg      2520
     gtacgtatgc tgctggataa aaacggcaac aacctggcgg cgcaggtaga gtttgaaacc      2580
     tttaaccgtc agcttaacgc ggttaaccgt cacaccggca gcaagctggt taacgcggtg      2640
     cagcaggatg ttcacgctat ccttcagctg ggggaagcgc agatcgagaa atctgcccgt      2700
     gcattgattg atgcagcgcg taacgaagcc gacgaaaaac tgtctgccga gctgtctcgt      2760
     ctggaagctc tgcgtgcagt gaacccgaac attcgtgacg acgaactgac cgccattgag      2820
     agcaaccgtc agcaggtaat ggaaagcctg gatcaggcag gctggcgtct ggatgccctg      2880
     cgtttgatcg ttgtaacgca tcagtaa                                          2907
//

If you have problems or comments...

PBIL Back to PBIL home page