(data stored in ACNUC7421 zone)

EMBL: CP000247.PE604

CP000247.PE604       Location/Qualifiers
FT   CDS_pept        complement(643742..644860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68640"
FT                   /db_xref="GOA:Q0TK91"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TK91"
FT                   /protein_id="ABG68640.1"
FT                   /translation="MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLIDTVKNQI
FT                   TAGEVKHDITESMLELATDVCRDINQAAGQFSAMQKVVLQAAADHHLEICGGGTHPFQK
FT                   WQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHVGCASGDDAIYLLHGLSRFVPHFIA
FT                   LSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPWVSNWQQFEALFRCLSYTTMIDSIKD
FT                   LHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLIQATAHWLLTERPFKHQEKDYLMYK
FT                   FNRFQACRYGLEGVITDPHTGDRRSLTEATLRLLEKIAPSAHKIGASSAIEALHRQVVS
FT                   GLNEAQLMRDFVADGGSLIGLVKKHCEIWAGE"
     atgccattac ccgattttca tgtttctgaa ccttttaccc tcggtattga actggaaatg        60
     caggtggtta atccgccggg ctatgactta agccaggact catcaatgct gattgacacg       120
     gttaaaaatc agatcacggc cggagaggta aagcacgata taaccgaaag tatgctggag       180
     ctggcgacgg atgtttgccg tgatatcaac caggctgccg ggcaattttc agcgatgcag       240
     aaagtcgtat tgcaggcagc ggcagaccat catctggaaa tttgcggcgg tggcacgcat       300
     ccgtttcaga aatggcagcg tcaggaggta tgcgataacg aacgctatca acgaacgctg       360
     gaaaactttg gctatctcat ccagcaggcg accgtttttg gtcagcatgt ccatgttggc       420
     tgcgccagtg gcgatgacgc catttatttg ctgcacggct tgtcacggtt tgtgccgcac       480
     tttatcgccc tttccgccgc gtcgccatat atgcagggaa cggatacgcg ttttgcctcc       540
     tcacgaccga atattttttc cgcctttccc gataatggcc caatgccgtg ggtcagtaac       600
     tggcaacaat ttgaagccct gtttcgctgc ctgagttaca ccacgatgat cgacagcatt       660
     aaagatctgc actgggatat tcgccccagc ccccattttg gtacggtgga agttcgggtg       720
     atggataccc cgttaaccct tagccacgcg gtaaatatgg cgggattaat tcaggccacc       780
     gcccactggt tactgacgga acgcccgttt aaacatcagg agaaagatta cctgatgtat       840
     aaattcaacc gtttccaggc ctgtcgctat gggctggaag gtgtcattac cgatccgcat       900
     actggcgatc gtcggtcact aacggaagcc accttgcgtt tactggaaaa aatcgcccct       960
     tctgcacata aaattggcgc atcgagcgca attgaagcac tgcaccgtca ggtcgtcagt      1020
     ggtctgaatg aagcgcagct aatgcgtgat ttcgtcgccg atggtggctc gctaattggg      1080
     ctggtgaaaa agcattgtga gatctgggcc ggagaataa                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page