(data stored in ACNUC7421 zone)

EMBL: CP000247.PE607

CP000247.PE607       Location/Qualifiers
FT   CDS_pept        complement(646374..648623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0615"
FT                   /product="ferrienterobactin receptor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68643"
FT                   /db_xref="GOA:A0A454A263"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A263"
FT                   /protein_id="ABG68643.1"
FT                   /translation="MNKKIHSLALLVNLGIYGVALPVLAEETSDNAVSHDDTIVVTAAE
FT                   QNLQAPGVSTITADEIRKNPVARDVSEIIRTMPGVNLTGNSTSGQRGNNRQIDIRGMGP
FT                   ENTLILIDGKPVSSRNSVRQGWRGERDTRGDTSWVPPEMIERIEVLRGPAAARYGNGAA
FT                   GGVVNIITKKGSGEWHGSWDAYFNAPEHKEEGATKRTNFSLTGPLGDEFSFRLYGNLDK
FT                   TQADAWDINQGHQSARAGTYATTLPAGREGVINKDINGVVRWDFAPLQSLELEAGYSRQ
FT                   GNLYAGDTQNTNSDAYTRSKYGDETNRLYRQNYSLTWNGGWDNGVTTSNWVQYEHTRNS
FT                   RIPEGLAGGTEGKFNEKAAQDFVDIDLDDVMLHSEVNLPIDFLVNQTLTLGTEWNQQRM
FT                   KDLSSNTQALTGTNTGGAIDGVSATDRSPYSKAEIFSLFAENNMELTDSTIVTPGLRFD
FT                   HHSIVGNNWSPALNISQSLGDDFTLKMGIARAYKAPSLYQTNPNYILYSKGQGCYASAG
FT                   GCYLQGNDDLKAETSINKEIGLEFKRDGWLAGVTWFRNDYRNKIEAGYVAVGQNAVGTD
FT                   LYQWDNVPKAVVEGLEGSLNVPVSETVMWTNNITYMLKSENKTTGDRLSIIPEYTLNST
FT                   LSWQAREDLSMQTTFTWYGKQQPKKYNYKGQPAVGPETKEISPYSIVGLSATWDVTKNV
FT                   SLTGGVDNLFDKRLWRAGNAQTTGDLAGANYIAGAGAYTYNEPGRTWYMSINTHF"
     atgaacaaga agattcattc cctggccttg ctggtcaatc tggggattta tggggtagct        60
     ctgccagtac tggcagaaga aacaagcgat aatgccgttt cacatgacga taccatcgtg       120
     gtcaccgctg ccgagcaaaa cttgcaggct cccggcgttt cgaccattac cgcagatgaa       180
     atccgcaaaa acccggttgc ccgcgatgta tcggagatca ttcgtaccat gcctggcgtt       240
     aacctgaccg gtaactccac cagtggtcag cgtggtaata accgccagat tgatattcgc       300
     ggcatgggtc cggaaaacac gctgattttg attgacggca agccggtaag cagccgtaac       360
     tctgtgcgtc agggctggcg tggcgagcgc gatacccgtg gtgatacctc ctgggtgccg       420
     cctgaaatga ttgaacgtat tgaagttcta cgtggtccgg cagctgcgcg ttatggcaac       480
     ggcgcggcgg gcggcgtggt taacatcatt accaaaaaag gcagtggtga gtggcacggc       540
     tcctgggatg cttatttcaa tgcgccagaa cataaagagg aaggtgccac caaacgcacc       600
     aacttcagcc tgaccggtcc gctgggcgac gaattcagct tccgcttgta tggcaacctc       660
     gacaaaaccc aggctgacgc gtgggatatc aaccagggcc atcagtccgc gcgtgccgga       720
     acgtatgcca cgacgttacc agccgggcgc gaaggggtga tcaacaaaga tattaatggc       780
     gtggtgcgct gggacttcgc gcctctgcag tcactcgaac tggaagcggg ctacagccgc       840
     cagggtaacc tgtatgcggg tgatacgcag aacaccaact ctgacgctta cactcgctcg       900
     aaatatggcg atgaaaccaa ccgcctgtat cgccagaact actcgctgac ctggaacggt       960
     ggctgggata acggcgtgac caccagcaac tgggtgcagt acgaacacac ccgtaactcg      1020
     cgtattccgg aaggtctggc gggcggtact gaagggaaat ttaacgaaaa agcggcacag      1080
     gattttgtag atatcgatct tgatgacgtg atgctgcaca gcgaagttaa cctgccgatt      1140
     gatttcctcg taaaccaaac gctgacgctg ggtacagagt ggaatcagca acggatgaag      1200
     gacttaagtt ccaacaccca ggcgctgacc ggaacgaata ccggcggtgc tattgatggt      1260
     gtgagtgcca ccgaccgtag cccatattca aaagcagaaa ttttctcgct gtttgccgaa      1320
     aacaatatgg agctgactga cagcaccatc gtaacgccgg ggctgcgttt cgatcatcac      1380
     agtattgtcg gcaataactg gagcccggcg ctgaacatat cgcaaagttt aggcgatgac      1440
     ttcacgctga aaatgggcat cgcccgcgcc tataaagcgc cgagtctgta ccagactaac      1500
     ccaaactaca ttctctacag taaaggtcag ggctgctatg ccagcgcggg cggctgctat      1560
     ctgcaaggta atgatgacct gaaagcagaa accagcatca acaaggagat tggtctggag      1620
     ttcaaacgcg acggctggct ggcgggcgtg acctggttcc gtaacgatta tcgcaataag      1680
     attgaagcgg gctatgtggc tgtagggcaa aacgcagtcg gcaccgatct ctatcagtgg      1740
     gataacgtac cgaaagcggt ggttgaaggt ctggaaggat cgttaaacgt accggttagc      1800
     gaaacggtga tgtggaccaa taacatcact tatatgctga agagtgaaaa caaaaccacg      1860
     ggcgaccgtt tgtcgatcat cccggaatat acgttgaact caacgctgag ctggcaggca      1920
     cgggaagatt tgtcgatgca aacgaccttc acctggtacg gcaagcagca gccgaagaag      1980
     tacaactaca aaggtcagcc agcggttgga ccggaaacca aagaaatcag tccgtacagc      2040
     attgttggcc tgagcgcgac ctgggatgtg accaagaatg tcagtctgac cggcggcgtg      2100
     gacaacctgt tcgacaaacg tttgtggcgt gcgggtaatg cccagaccac gggcgatctg      2160
     gcaggagcca actatatcgc aggtgccggg gcgtatacct ataacgagcc gggacgtacg      2220
     tggtatatga gcattaatac tcacttctga                                       2250
//

If you have problems or comments...

PBIL Back to PBIL home page