(data stored in ACNUC7421 zone)

EMBL: CP000247.PE613

CP000247.PE613       Location/Qualifiers
FT   CDS_pept        complement(656324..657316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0621"
FT                   /product="ferric enterobactin transport system permease
FT                   protein FepG"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68649"
FT                   /db_xref="GOA:A0A454A245"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A245"
FT                   /protein_id="ABG68649.1"
FT                   /translation="MIYVSRRLIITCLLLLIACVMAGVWGLRSGAVTLETSQVFAALMG
FT                   DTPRSMTMVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGV
FT                   LVAMVLFGQDLTAIALAAMVGGIVTSLLVWLLAWRNGIDTFRLIIIGIGVRAMLVAFNT
FT                   WLLLKASLETALTAGLWNAGSLNGLTWAKTSPSAPIIILMLIAAALLVRRMRLLEMGDD
FT                   TACALGVSVERSRLLMMLVAVVLTAAATALAGPISFIALVAPHIARRISGTARWGLTQA
FT                   ALCGALLLLVADLCAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
     atgatttacg tctctcgccg attaattatc acctgtctgc tgctgctaat agcttgtgtg        60
     atggcaggcg tgtggggatt acgtagcggt gccgtcacgc tggaaacttc gcaggtattc       120
     gccgcgttga tgggcgacac gccgcgcagt atgacgatgg tggtcaccga atggcgttta       180
     ccacgcgtgc tgatggcgct gttgattggc gcggcgctgg gcgtcagcgg cgcgattttt       240
     cagtcgctga tgcgtaaccc gcttggcagc cctgacgtaa tgggctttaa caccggggcg       300
     tggagcggcg tgctggtggc gatggtgctg tttggtcagg acctgacggc tatcgcgctg       360
     gcagcaatgg tgggcggcat tgtcacttcg ctgctggtct ggctgctcgc ctggcgtaac       420
     ggtatcgaca cctttcggtt gattattatc ggtattggtg ttcgcgccat gctggtggcc       480
     tttaatacct ggctgttgct gaaagcgtct ttagaaacgg cgctaacagc gggtttgtgg       540
     aatgccggat cgctcaatgg cctgacgtgg gcaaaaacct cgccttccgc acccatcatt       600
     atattaatgt taattgccgc cgccttgctg gtgcggcgaa tgcgcttgct ggaaatgggc       660
     gatgataccg catgtgcgct gggcgtcagc gtcgaacgtt cgcggctgtt aatgatgctg       720
     gtcgccgtag tgcttaccgc agctgccact gccctggcgg ggccaatttc ctttattgct       780
     ttagtcgcgc cgcacattgc ccgccgcatc agtggcaccg ctcgctgggg gctaacccag       840
     gcggcgctgt gcggggcgct gttactgctg gtggccgatc tctgcgccca acaactgttt       900
     atgccgtatc aacttccggt tggcgtcgtt accgtcagcc tcggcggtat ttaccttatc       960
     gtcttgttaa ttcaggagtc tcgcaaaaaa tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page