(data stored in ACNUC7421 zone)

EMBL: CP000247.PE614

CP000247.PE614       Location/Qualifiers
FT   CDS_pept        complement(657313..658329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0622"
FT                   /product="ferric enterobactin transport system permease
FT                   protein FepD"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68650"
FT                   /db_xref="GOA:A0A454A278"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A278"
FT                   /protein_id="ABG68650.1"
FT                   /translation="MEVRMSGSVAVTRAIAVPGLLLLLIIATALSLLIGAKSLPASVVL
FT                   EALSGTCQSADCTIVLDARLPRTLAGLLAGGALGLAGALMQTLTRNPLADPGLLGVNAG
FT                   ASFAIVLGAALFGYSSAQEQLAMAFAGALVASLIVAFTGSQGGGQLSPVRLTLAGVALA
FT                   AVLEGLTSGIALLNPDVYDQLRFWQAGSLDIRNLHTLKVVLIPVLTAGATALLLSRALN
FT                   SLSLGSDTATALGSRVARTQLIGLLAITVLCGSATAVVGPIAFIGLMMPHMARWLVGAD
FT                   HRWSLPVTLLTTPALLLFADIIGRVIVPGELRVSVVSAFIGAPVLIFLVRRKTRGGA"
     atggaagttc gtatgtctgg ttctgttgcc gtgacacgcg ccattgccgt gcccggattg        60
     ctgttattac tgattatcgc gacggcatta agcctgctca ttggagcaaa atcactcccc       120
     gcttccgtag tgctggaggc gctctccggc acctgccaga gcgccgactg caccattgtg       180
     ctcgacgccc gtctgccgcg cacccttgcc ggtttactgg caggcggtgc gcttggcctt       240
     gccggggcgt taatgcaaac cctcacccga aacccacttg ccgatcctgg tttgcttggc       300
     gtgaacgccg gtgccagttt tgccattgtg ctgggcgcgg cgctgtttgg ttactcttcc       360
     gcgcaggagc aactggcgat ggccttcgcc ggggcgctgg tggcctcgtt gattgttgcc       420
     tttaccggca gccagggcgg cgggcagtta agtccggtgc gtttaaccct ggcgggcgtg       480
     gcgctggcgg cggtgctgga agggctgacc agcggcatcg ccctgcttaa tcccgacgtc       540
     tacgatcaac tgcgtttctg gcaagccggt tcgctggata ttcgcaatct acatacctta       600
     aaagtggtgc tgatcccggt gcttaccgct ggagcaactg cgctattact gagccgcgcg       660
     ctgaacagtt taagccttgg cagtgacacc gcgacggcgc tgggcagtcg cgtagcgcgc       720
     acacagttga ttggtctgct ggcaattacc gtgctttgtg gtagtgcgac ggcggtagtt       780
     ggcccgattg cctttattgg cctgatgatg ccgcacatgg cgcgctggct ggtaggtgcc       840
     gatcatcgct ggtcgctgcc cgtcacgcta ctcactaccc ctgccctgct gctgtttgcc       900
     gatatcattg ggcgggtgat tgttcccggc gaactgcgcg tttctgtagt cagtgccttt       960
     attggtgcac cagtgctgat cttcctcgta cgacgtaaaa cgcgaggtgg cgcatga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page