(data stored in ACNUC7421 zone)

EMBL: CP000247.PE616

CP000247.PE616       Location/Qualifiers
FT   CDS_pept        complement(659682..660638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0624"
FT                   /product="ferrienterobactin-binding periplasmic protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68652"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A266"
FT                   /protein_id="ABG68652.1"
FT                   /translation="MRLAPLYRNALLLTGLLLSGIAAVQAADWPRQITDSRGTHTLESQ
FT                   PQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIG
FT                   EPSAEAVATQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEIT
FT                   GHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQL
FT                   GFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLL
FT                   AHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF"
     gtgagactcg ccccgctcta ccgcaacgcc cttctattaa caggactttt gctttcagga        60
     atagcagcag ttcaggccgc cgactggccg cgtcagatta ctgacagccg tggcactcat       120
     accctggaaa gccagccgca gcgtattgtt tccaccagcg tcaccctgac cggctcactg       180
     ctggcgattg atgctccggt gatcgccagc ggcgcgacca cgccaaataa ccgcgtagcg       240
     gatgaccagg gctttttacg ccagtggagc aaggtggcga aagaacgcaa actgcaacgg       300
     ctctatatcg gcgaaccgag tgcagaagcc gttgccacgc aaatgccgga tctgatttta       360
     attagcgcaa ccggcggcga ttcggcgctg gcgctgtacg atcagctttc taccatcgcc       420
     ccaacattaa tcatcaatta cgacgacaaa agctggcagt cgctgttaac gcagcttggc       480
     gaaattaccg ggcatgagaa acaagcggca gagcggattg cacagtttga taagcaactg       540
     gcggcggcga aagagcaaat caaattaccg ccgcagccgg tcactgccat cgtctatacc       600
     gccgctgcac acagtgccaa tctctggacg ccggaatcag cacaagggca gatgctggaa       660
     caactcggct ttacgctggc gaagttgccc gcaggcttaa acgccagcca aagccagggc       720
     aaacgccatg acatcattca gcttggtgga gagaatctgg ctgcagggtt aaatggcgag       780
     tcactattcc tgttcgccgg tgatcagaaa gacgccgatg ctatttatgc taatccgctg       840
     ctcgcgcacc tgcctgcagt acaaaacaag caggtttatg cgctgggaac cgagacgttc       900
     cgcctggatt actacagcgc catgcaagtg ctggatagac ttaaggcgct gttttaa          957
//

If you have problems or comments...

PBIL Back to PBIL home page