(data stored in ACNUC7421 zone)

EMBL: CP000247.PE621

CP000247.PE621       Location/Qualifiers
FT   CDS_pept        665242..665655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0629"
FT                   /product="hypothetical protein YbdB"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68657"
FT                   /db_xref="GOA:A0A454A252"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR026576"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A252"
FT                   /protein_id="ABG68657.1"
FT                   /translation="MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTR
FT                   THQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQP
FT                   LHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG"
     atgatctgga aacgccattt aacgctcgac gagctgaacg ccaccagcga taacacaatg        60
     gtggcgcatc tgggaattgt gtatacccgt ctgggcgatg atgtgctgga agccgaaatg       120
     ccggttgata cccgtactca tcagccgttt ggcctgctgc atggcggcgc gtcggcggcg       180
     ctggcggaaa cgctgggatc gatggccgga tttatgatga cccgcgacgg acagtgtgtg       240
     gtgggcacgg aacttaacgc cacacatcat cgcccggtgt ctgagggaaa ggtgcgcggt       300
     gtctgccaac cgctgcatct tggacgacaa aatcagagct gggaaatcgt cgttttcgat       360
     gaacaggggc ggcgttgctg cacctgtcgg ctgggcacag cggttttggg atga             414
//

If you have problems or comments...

PBIL Back to PBIL home page