(data stored in ACNUC7421 zone)

EMBL: CP000247.PE622

CP000247.PE622       Location/Qualifiers
FT   CDS_pept        665836..667941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0630"
FT                   /product="carbon starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68658"
FT                   /db_xref="GOA:A0A454A262"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A262"
FT                   /protein_id="ABG68658.1"
FT                   /translation="MNKSGKYLVWTVLSVMGAFALGYIALNRGEQINALWIVVASVCIY
FT                   LIAYRFYGLYIAKNVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYLPGMIWLLAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGPTAGVIA
FT                   LVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLALFMGIYLRYLRPGRIGEVS
FT                   VIGLVFLIFAIISGGWVAESPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLLAPRDY
FT                   LSTFLKIGTIVGLAVGILIMRPTLTMPALTKFVDGTGPVWTGNLFPFLFITIACGAVSG
FT                   FHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVSACIIDPGVYFAMNSPMAV
FT                   LAPAGTADVVASAAQVVSSWGFAITPDTLNQIASEVGEQSIISRAGGAPTLAVGMAYIL
FT                   HGALGGMMDVAFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPA
FT                   NLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQ
FT                   RYAWVALVPTAWLLICTLTAGWQKAFSPDAKVGFLAIANKFQAMIDSGNIPSQYTESQL
FT                   AQLVFNNRLDAGLTIFFMVVVVVLALFSIKTALAALKEPKPTAKETPYEPMPENVEEIV
FT                   AQAKGAH"
     atgaacaaat cagggaaata cctcgtctgg acagtgctct ctgtaatggg agcatttgct        60
     ctgggataca ttgctttaaa tcgtggggaa cagatcaacg cgctgtggat tgtggtggcg       120
     tcggtctgta tctatctgat cgcttaccgt ttttatgggc tgtatatcgc caaaaatgtg       180
     ctggcggttg acccgacgcg tatgacgcca gcggtgcgcc ataacgacgg gctggactat       240
     gtgccgacgg acaaaaaagt gctgttcggt caccattttg cggccattgc cggagcaggt       300
     ccgttggttg ggccggtact ggcggcgcaa atgggttacc tgccagggat gatctggctg       360
     ctcgccgggg tggttctcgc cggtgcggtg caggatttca tggtgctgtt tgtttccacg       420
     cgccgtgacg gtcgctcgct gggtgagctg gtcaaagaag agatggggcc aaccgccggg       480
     gtgattgcgc tggtggcctg ctttatgatc atggtcatta tccttgccgt gctggcgatg       540
     atcgtggtta aagccctgac tcatagcccg tggggaacgt ataccgttgc gttcaccatt       600
     ccgctggcgc tgtttatggg gatctacttg cgttatctgc gtccggggcg tattggcgaa       660
     gtgtcggtga ttggtctggt gttcctgatt ttcgccatta tctctggcgg ctgggtggca       720
     gaaagtccga cgtgggcacc gtactttgac tttaccggcg tgcagctgac ctggatgctg       780
     gtgggttacg gttttgtggc ggcggtgctg ccggtgtggt tgctgctggc tccgcgtgac       840
     tacctctcaa ccttcctgaa aatcgggact atcgtcggtc tggcggtggg cattttgatt       900
     atgcgcccga cgctgaccat gcctgcgcta actaaatttg tcgatggcac tggcccggta       960
     tggaccggta acctgttccc gttcctgttt atcaccatcg cctgtggcgc ggtgtctggc      1020
     ttccatgcac tgatctcttc cggcaccacg ccgaagatgc tggcgaacga agggcaggcg      1080
     tgttttatcg gctacggtgg aatgttaatg gaatccttcg tggcgattat ggcgctggtt      1140
     tccgcctgta tcatcgatcc gggtgtgtac ttcgccatga acagcccgat ggcggtgctg      1200
     gctccggcag ggacggcgga tgtggttgct tctgccgcgc aggtggtgag tagctggggc      1260
     tttgcgatta ccccggatac gctaaaccag attgccagcg aagtgggtga acagtcgatc      1320
     atttcccgtg cgggcggagc gccgaccctg gcggtgggga tggcctacat tctgcacggt      1380
     gcgctgggcg gcatgatgga tgtggcgttc tggtatcact tcgccattct gtttgaagca      1440
     ctgtttattc tgacggcggt ggatgcgggt acgcgtgctg cgcgctttat gttgcaggat      1500
     ctgctgggcg tggtgtctcc gggcctgaaa cggaccgatt cactgcctgc taacctgctg      1560
     gcaacggcgc tgtgcgtgct ggcgtggggc tacttcctgc atcagggcgt ggtcgatccg      1620
     ctgggcggta ttaacacctt gtggccgctg tttggtattg ccaaccagat gctggcaggg      1680
     atggcgctga tgctttgtgc tgtggtgctg ttcaaaatga aacgtcaacg ttacgcctgg      1740
     gtggcgctgg taccaacggc ctggctgctg atttgtaccc tgaccgcagg ctggcagaaa      1800
     gcgtttagcc cggatgcgaa agtcggcttc ctggcgattg ctaacaagtt ccaggcaatg      1860
     atcgacagcg gcaatattcc gtcgcagtat actgagtcac aactggcgca actggtgttc      1920
     aacaaccgtc ttgatgccgg gttaaccatc ttctttatgg tggtcgtggt ggttctggcg      1980
     ctgttctcga ttaagacggc actggcggca ttgaaagagc cgaagccaac ggcgaaagaa      2040
     acgccatatg agccgatgcc ggaaaatgtc gaggagatcg tggcgcaggc gaaaggcgcg      2100
     cactaa                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page