(data stored in ACNUC7421 zone)

EMBL: CP000247.PE626

CP000247.PE626       Location/Qualifiers
FT   CDS_pept        complement(670618..671247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0634"
FT                   /product="hypothetical protein YbdM (ParB-like nuclease
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68662"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A274"
FT                   /protein_id="ABG68662.1"
FT                   /translation="MGDTMQQRLTQDLTQFLASLPEDDRIKAINEIRMAIHQVSPFREE
FT                   PVDCVLWVKNSQLMPNDYNPNNVAPPEKKLLKKSIEIDGFTQPIVVTHTDKNALEIVDG
FT                   FHRHEIGKGSSSLKLRLKGYLPVTCLEGTRNQRIAATIRHNRARGRHQITAMSEIVREL
FT                   SQLGWDDNKIGKELGMDSDEVLRLKQINGLQELFADRQFSRAWTVK"
     atgggggata ctatgcaaca acgattaacg caggatttaa cccaatttct cgccagcttg        60
     ccggaagatg atcgcatcaa agcgattaat gaaatccgca tggcgatcca tcaggttagc       120
     ccctttcgtg aagagccagt ggattgcgtt ctgtgggtta aaaacagcca acttatgcct       180
     aatgattaca acccaaacaa cgtggcacca cccgaaaaaa aactgctgaa aaaatccatt       240
     gaaatagatg gttttaccca acccattgtg gtcacgcata cggataaaaa tgctctggaa       300
     atcgtggatg gttttcaccg ccatgaaatt ggtaaaggct catcatcgtt aaaattacgc       360
     ttaaaaggtt atttgccggt gacctgtctg gaaggtacgc gtaatcaacg catcgccgcg       420
     actattcgtc ataatcgcgc tcgtggacgt caccaaatca ctgccatgtc agaaatcgtc       480
     cgagaactca gccagttggg atgggacgat aataaaatag gcaaagagct gggaatggac       540
     agcgacgaag tgttacgcct gaagcaaatt aacggcctgc aagagttgtt tgccgaccgt       600
     caattttccc gcgcctggac ggttaaataa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page