(data stored in ACNUC7421 zone)

EMBL: CP000247.PE66

CP000247.PE66        Location/Qualifiers
FT   CDS_pept        72461..73309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68106"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0X0"
FT                   /protein_id="ABG68106.1"
FT                   /translation="MSKRNDITDGIFATTKKYGLVYTEELGWIDLGHAQGQDARILKRK
FT                   LEQEHFSTYYDEFHDWYFPVDYHQEMGIRKKILGVDLTFHTGVYTKVMVRSCLSPTLKA
FT                   RVALTLMYGTAKRFEAWQNSFIFNWYTDSGFSAEDLVSDLIGFYRVFGTGPDPLLLAKP
FT                   LSYTKALQIWDTYGAPGNFKNTEFTPFLFTTHPPFKKNQLIKKKLPEWLNYIKPLDESF
FT                   STLLYNQYNNRPVTNYYKDKNRINHELYSSLSSSGAIKFSESPFERPLFLFLNPHYPHR
FT                   S"
     atgagcaaac gtaacgatat tactgatgga atatttgcaa caacgaaaaa gtatggatta        60
     gtttataccg aagagttagg ttggatcgat ttggggcatg ctcagggaca agatgccaga       120
     atattaaaaa gaaaattgga gcaagaacat ttttcaacat attacgatga atttcatgat       180
     tggtattttc ctgttgatta tcatcaggaa atgggaattc ggaaaaaaat attaggagta       240
     gatcttacat ttcataccgg tgtttatacg aaggttatgg ttcgttcatg tctttcaccc       300
     actcttaaag caagagttgc cttaacgtta atgtatggaa ctgcgaagag gtttgaagca       360
     tggcaaaact catttatttt taactggtat actgatagcg gatttagtgc agaagattta       420
     gtctcagact tgattggttt ttatcgtgta tttggaacag gccccgatcc acttttattg       480
     gcaaaacctt tatcttacac aaaagcctta caaatatggg atacatatgg agcgccaggg       540
     aattttaaaa atactgagtt tacgccattc ttatttacaa cccatcctcc ttttaaaaaa       600
     aatcaactaa taaaaaagaa gcttccagaa tggttaaatt atataaagcc attagatgag       660
     tctttttcaa cattgttata taatcaatat aataatagac ctgttactaa ttattataaa       720
     gataaaaaca gaataaatca tgagttgtat agttcattat caagttcggg agctataaag       780
     ttttcagaat ctccctttga aagaccgctt tttcttttct taaaccctca ttatccgcac       840
     aggtcgtga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page