(data stored in ACNUC7421 zone)

EMBL: CP000247.PE68

CP000247.PE68        Location/Qualifiers
FT   CDS_pept        73893..74657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0068"
FT                   /product="DedA family integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68108"
FT                   /db_xref="GOA:A0A454A0X1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0X1"
FT                   /protein_id="ABG68108.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVLLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWYAWLAGIIGCLLGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLATAVFLWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLIRHPLMPVYIDILRKVVGV"
     atgcaagcat tgctggaaca ctttattacc caatccaccg tgtattcatt gatggcggtg        60
     ttattggtgg cctttctgga gtcgctggcg ctggtcggtt tgattctacc cggtacggtg       120
     ctgatggcgg ggctgggagc actgattggc agcggtgagt taagtttctg gtacgcctgg       180
     ctggcgggga ttattggctg cctgctgggc gactggatct ccttctggct gggctggcgt       240
     tttaaaaagc cgttgcatcg ctggtcattt ctgaagaaga acaaagcatt actcgataaa       300
     accgaacatg cgctgcatca gcacagcatg ttcaccattc tggtcggtcg ttttgtcggc       360
     ccgacgcgtc cgctggtgcc aatggtggcg ggaatgctgg atctcccggt ggcaaaattt       420
     attacgccga atattatcgg ctgcttgctg tggccaccgt tttacttcct gccggggatt       480
     ctggcgggtg cggcgatcga tattcctgcc gggatgcaga gcggtgagtt taaatggttg       540
     ctgctggcaa cagcggtgtt tttgtgggtt ggaggctggc tgtgctggcg gttatggcgc       600
     agcggtaaag cgactgaccg tttgagtcat tatttgtccc gcggtcgttt gttgtggctg       660
     acgccgttga tttctgccat cggcgtggtg gcgctggtgg tgttaattcg ccacccgttg       720
     atgccggtgt atatcgatat tttgcgtaaa gtggttgggg tttag                       765
//

If you have problems or comments...

PBIL Back to PBIL home page