(data stored in ACNUC7421 zone)

EMBL: CP000247.PE72

CP000247.PE72        Location/Qualifiers
FT   CDS_pept        complement(78186..79841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0072"
FT                   /product="putative ABC transporter periplasmic solute
FT                   binding protein (YabN protein)"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68112"
FT                   /db_xref="GOA:Q0TLR9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023767"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TLR9"
FT                   /protein_id="ABG68112.1"
FT                   /translation="MPSARLQQQFIRLWQCCEGKSQETTLNELAALLSCSRRHMRTLLN
FT                   TMQDRGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKATVR
FT                   QMLVSHLGRSFRQGRHILRVLYYRPLRNLLPGSALRRSETHIARQIFSSLTRINEENGE
FT                   LEADIAHHWQQISPLHWRFFLRPGVHFHHGRELEMDDVIFSLKRINTLPLYSHIADIVS
FT                   PTPWTLDIHLTQPDRWLPLLLGQVPAMILPREWETLSNFASHPIGTGPYAVIRNSTNQL
FT                   KIQAFDDFFGYRALIDEVNVWVLPEIADEPAGGLMLKGPQGEEKEIESRLEEGCYYLLF
FT                   DSRTHRGANQQVRDWVSYVLSPTNLVYFAEEQYQQLWFPAYGLLPRWHHARIIKSEKPA
FT                   GLESLTLTFYQDHSEHRVIAGIMQQILASHQVTLEIKEISYDQWHEGEIESDIWLNSAN
FT                   FTLPLDFSLFAHLCEVPLLQHCIPIDWQADAARWRNGEMNLANWCQQLVASKAMVPLIH
FT                   HWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDP"
     atgccatctg ctcgtctgca acaacagttc atccgcctgt ggcaatgctg cgagggtaaa        60
     tctcaggaga ccactctcaa cgaactggca gcgttactga gttgctcgcg tcgtcatatg       120
     cgcaccctgc tcaacaccat gcaggatcgc ggctggctga cgtgggaagc ggaagtcggg       180
     cgcggtaaac gttcacgcct gacattcctc tataccgggc tggcgcttca gcaacagcgg       240
     gcggaagacc tgctggagca ggatcgtatc gaccaactag tgcagttggt tggcgacaaa       300
     gcgactgtgc ggcaaatgct ggtttctcat ttgggccgca gcttccgcca gggacggcac       360
     atcctgcgcg tgctctacta tcgtccgttg cgtaatctgc tacctggcag cgcattgcgc       420
     cgttctgaaa cccatatcgc ccggcaaatc ttcagttcgc taacgcgcat aaatgaggaa       480
     aatggggaac tggaagcaga catcgcccac cactggcagc aaatatcacc gcttcactgg       540
     cgtttctttt tgcgtccagg tgtccatttt caccatggtc gtgaactgga aatggacgat       600
     gtgatcttct ctttaaaacg aatcaatacg cttccgctct attcgcatat tgctgacatt       660
     gtgtcgccga cgccctggac gctggatatc catctcacgc aaccggaccg ctggttgccg       720
     ttactgctgg ggcaagttcc ggcaatgatc ctgccgcgcg aatgggaaac cctcagtaac       780
     tttgccagcc atcccatcgg caccggtccg tatgcggtga tccgcaacag caccaatcaa       840
     ctgaaaattc aggcattcga tgacttcttc ggttaccggg cattaatcga cgaagttaac       900
     gtctgggttc tgccggaaat tgccgacgag ccagccggag ggctgatgct aaaaggtcca       960
     cagggcgagg aaaaagagat tgaaagccgc ctggaggaag gttgctacta tttactgttc      1020
     gacagccgca cccatcgagg ggcgaatcag caagtcagag actgggtaag ctatgtgctt      1080
     tctccgacga atctggtcta tttcgctgag gaacagtacc agcaactgtg gttcccggct      1140
     tatggactgc tcccccgttg gcaccatgcc cgcatcataa agagcgaaaa accggctggt      1200
     ctggaaagcc tcaccctgac cttttatcag gatcacagcg agcatcgggt gattgccggg      1260
     atcatgcagc agattctggc aagtcaccag gtcacgctgg aaatcaaaga gatcagctac      1320
     gatcagtggc atgaaggaga gatcgagagc gatatctggc ttaacagcgc caactttacg      1380
     ctgccgctgg atttttcgct gttcgcgcac ttgtgcgagg tgccgctgct ccaacactgt      1440
     attccgatcg actggcaagc cgacgccgcc cgctggcgca atggcgaaat gaacctggcg      1500
     aactggtgcc aacaactggt cgccagcaaa gcaatggtgc cacttatcca ccactggctg      1560
     atcattcagg ggcaacgtag tatgcgcggc ctgcgcatga acaccctcgg ctggttcgat      1620
     tttaaatcag cgtggtttgc accaccggat ccatga                                1656
//

If you have problems or comments...

PBIL Back to PBIL home page