(data stored in ACNUC7421 zone)

EMBL: CP000247.PE73

CP000247.PE73        Location/Qualifiers
FT   CDS_pept        complement(80169..80774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0073"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68113"
FT                   /db_xref="GOA:Q0TLR8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TLR8"
FT                   /protein_id="ABG68113.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAKVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIASYEEKQPAFMR"
     atggcagaga aatttatcaa acacacaggc ctggtggttc cgttggatgc cgccaatgtc        60
     gataccgatg caatcatccc gaaacagttt ttgcagaaag tgacccgtac gggttttggc       120
     gcgcatctgt ttaacgactg gcgttttctg gatgaaaaag gccaacagcc aaacccggac       180
     ttcgtgctga acttcccgca gtatcagggc gcttccattt tgctggcacg agaaaacttc       240
     ggctgcggtt cctcgcgtga gcacgcgccg tgggcattga ccgattacgg ttttaaggtg       300
     gtgattgcgc cgagttttgc tgacatcttc tacggcaata gctttaacaa ccagctgctg       360
     ccggtgaaat taagcgatgc aaaagtggat gagctgtttg cgctggtgaa agccaatccg       420
     gggattcatt ttgatgtaga cctggaagcg caagaggtga aagcgggaga gaaaacttat       480
     cgctttacca tcgatgcctt ccgccgccac tgcatgatga acggtctgga cagcatcggc       540
     ctgactctgc agcacgacga cgcaattgcg tcttatgaag agaagcaacc ggcgtttatg       600
     cgttag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page