(data stored in ACNUC7421 zone)

EMBL: CP000247.PE74

CP000247.PE74        Location/Qualifiers
FT   CDS_pept        complement(80785..82185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0074"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68114"
FT                   /db_xref="GOA:Q0TLR7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TLR7"
FT                   /protein_id="ABG68114.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHGRPVRQPGKTFATMDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQA
FT                   EEISPQVTWGTNPGQVISVNDNIPDPASFADPVERASAEKALAYMGLKPGIPLTEVAID
FT                   KVFIGSCTNSRIEDLRAAAEIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRNIK"
     atggctaaga cgttatacga aaaattattc gacgctcacg tagtgtacga agccgaaaac        60
     gaaaccccgc tgttatatat cgaccgccac ctggtgcatg aagtgacctc accgcaggcg       120
     ttcgatggtc tgcgcgccca cggtcgcccg gtacgtcagc cgggcaaaac cttcgccacc       180
     atggatcaca acgtctctac ccagacgaaa gacattaatg cctgcggtga aatggcgcgc       240
     atccagatgc aggagctgat caaaaactgc aaagaatttg gcgtcgagct gtatgacctg       300
     aatcacccgt atcaggggat cgtccacgta atggggccgg aacagggcgt gaccttgccg       360
     gggatgacca ttgtctgcgg cgactcacat accgccaccc acggcgcgtt tggcgcactg       420
     gcctttggta tcggcacttc cgaagttgaa cacgtactgg caacgcaaac cctgaaacag       480
     ggccgggcga agaccatgaa aattgaagtc cagggcaaag ccgcgccggg cattaccgca       540
     aaagatatcg tgctggcaat tattggtaaa accggcagcg caggcggtac cgggcatgtg       600
     gtggaatttt gcggcgaagc aatccgtgat ttaagcatgg aaggtcgtat gaccctgtgc       660
     aatatggcaa tcgaaatggg cgcaaaagcc ggtctggttg caccggacga aaccaccttt       720
     aactatgtta aaggccgtct gcatgcgccg aaaggcaaag atttcgacga cgccgttgcc       780
     tactggaaaa ccctgcaaac cgacgaagga gcaactttcg ataccgttgt cactctgcaa       840
     gcagaagaga tttcgccgca ggtcacctgg ggcaccaatc caggccaggt gatttctgtg       900
     aacgacaata ttcccgatcc ggcttcgttt gccgatccgg ttgaacgcgc gtcggcagaa       960
     aaagcgctgg cctatatggg gctgaaaccg ggtattccgc tgacagaagt ggctatcgac      1020
     aaagtgttta ttggttcctg tactaactcg cgtattgaag atttacgcgc ggcagcggaa      1080
     atcgccaaag gccggaaagt cgcgccaggc gtacaagcgc tggtggttcc cggctccggt      1140
     ccggttaaag cccaggcgga agcggaaggt ctggacaaaa tttttatcga agctggtttt      1200
     gaatggcgct tgccaggttg ttcaatgtgc ctggcgatga acaacgaccg cctgaatccg      1260
     ggcgaacgtt gcgcctccac cagcaaccgt aactttgaag gccgccaggg gcgcggcggg      1320
     cgcacgcatc tggtcagtcc ggcaatggct gccgccgcgg ctgtgaccgg acatttcgcc      1380
     gacattcgca acattaaata a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page