(data stored in ACNUC7421 zone)

EMBL: CP000247.PE79

CP000247.PE79        Location/Qualifiers
FT   CDS_pept        86948..88672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0079"
FT                   /product="acetolactate synthase isozyme III large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68119"
FT                   /db_xref="GOA:A0A454A0X9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0X9"
FT                   /protein_id="ABG68119.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPANKLPYVWPESVSMRSYNPTTSGHKGQIKRALQTLVAAKKPVVYVGGGAITAGC
FT                   HLQLKEAVEALNLPVVSSLMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESA
FT                   HQPLDEIRDWWQQIEQWRARQCLKYDTHSEKIKPQAVIETLWRLTNGDAYVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVVNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQ
FT                   ISHPQELESKLSEALEQVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
     atggagatgt tgtctggagc cgagatggtc gtccgatcgc ttatcgatca gggcgttaaa        60
     caagtattcg gttatcctgg aggcgcggtc cttgatattt acgatgcatt gcataccgtg       120
     ggtggtatcg atcatgtttt agttcgccat gagcaggcgg cggtgcatat ggccgatggt       180
     ctggcgcgcg cgaccgggga agtcggcgtc gtgctggtaa cgtcgggtcc aggggcgacc       240
     aatgcgatta ctggcattgc caccgcttat atggattcca ttccattagt tgtcctttcc       300
     gggcaggtag cgacttcgtt gataggttat gatgcctttc aggagtgcga catggtgggg       360
     atttctcgcc cggtggttaa acacagtttt ctggttaagc aaacggaaga cattccgcag       420
     gtgctgaaaa aggctttctg gctagcggca agtggtcgtc ctggacccgt ggtcgttgat       480
     ttaccgaaag atattctaaa tccggcgaac aaattaccct atgtctggcc ggagtcggtc       540
     agtatgcgtt cttacaatcc cacgacctcc gggcataaag ggcaaattaa gcgcgctctg       600
     caaacgctgg tggcggcaaa aaaaccggtt gtctacgtag gcggtggggc aatcacggcg       660
     ggctgccatc tgcagttgaa agaagcggtg gaggcgttga atctgcccgt tgtttcctct       720
     ttgatggggc tgggggcgtt tccggcaacg catcgccagg cactgggcat gttgggaatg       780
     cacggtacct acgaagccaa tatgacgatg cataacgcgg atgtgatttt cgccgtcggg       840
     gtacgttttg atgaccgaac gacgaacaat ctggcaaagt actgcccaaa tgccactgtt       900
     ctgcatatcg atattgatcc aacctcaatt tctaaaaccg tgactgctga tatcccgatt       960
     gtgggggatg ctcgccaggt cctcgaacaa atgcttgaac tcctgtcgca agaatccgcc      1020
     catcaaccgc tggatgagat ccgcgactgg tggcagcaga ttgaacagtg gcgcgctcgt      1080
     cagtgcctga aatatgacac tcacagtgaa aagattaaac cgcaggcggt gatcgagact      1140
     ctttggcggt tgactaatgg ggacgcttac gtgacgtccg atgtcgggca gcaccagatg      1200
     tttgctgcgc tttattatcc attcgacaaa ccgcgtcgct ggatcaactc tggcggcctc      1260
     ggcacgatgg gttttggttt acctgcggca ctgggcgtca aaatggcgtt gccagaagaa      1320
     accgtggttt gcgtcactgg tgacggcagt attcagatga acatccagga actgtctacc      1380
     gcgttgcaat atgagttgcc cgtactggtg gtgaatctca ataaccgcta tctggggatg      1440
     gtgaagcagt ggcaggacat gatctattcc ggccgtcatt cacaatctta tatgcagtcc      1500
     ttaccagact tcgtccgtct ggcggaagcc tatggtcacg tcgggatcca gatctctcat      1560
     ccgcaagaac tggaaagcaa acttagcgag gcgctggaac aggtgcgcaa taatcgcttg      1620
     gtgtttgttg atgttaccgt cgatggcagt gagcacgtct acccgatgca gattcgcggg      1680
     ggcggaatgg atgaaatgtg gttaagcaaa acggagagaa cctga                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page