(data stored in ACNUC7421 zone)

EMBL: CP000247.PE80

CP000247.PE80        Location/Qualifiers
FT   CDS_pept        88675..89166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0080"
FT                   /product="acetolactate synthase isozyme III small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68120"
FT                   /db_xref="GOA:A0A454A0X4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0X4"
FT                   /protein_id="ABG68120.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
     atgcgccgga tattatcagt cttactcgaa aatgaatcag gcgcgttatc ccgcgtgatt        60
     ggcctttttt cccagcgtgg ctacaacatt gaaagcctga ccgttgcgcc aaccgacgat       120
     ccgacattat cgcgtatgac cattcagacc gtgggcgatg aaaaagtgct tgagcaaatc       180
     gaaaagcaat tacacaagct ggtcgatgtc ttgcgcgtga gcgagttggg gcagggcgcg       240
     cacgttgagc gggaaatcat gctggtgaaa attcaggcca gcggttacgg gcgtgacgaa       300
     gtgaaacgta atacggaaat attccgtggg caaattatcg atgtcacacc ctcgctttat       360
     accgttcaat tagcaggcac cagcgataag cttgatgcat ttttagcatc gattcgcgat       420
     gtggcgaaaa ttgtggaagt tgctcgctct ggtgtggtcg gactttcacg cggcgataaa       480
     ataatgcgtt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page