(data stored in ACNUC7421 zone)

EMBL: CP000251.PE102

CP000251.PE102       Location/Qualifiers
FT   CDS_pept        124186..125745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0103"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79880"
FT                   /db_xref="GOA:Q2IM48"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79880.1"
FT                   /translation="MTRSLRLLPVLLAAALGCAGSRPAPAPAAPPAAPPQAAAAPAGAD
FT                   RSQLPALGAAPELHLPQQRHFALANGLRVRLVEHRRLPIVALNLVVRAGAVNDPARLPG
FT                   LASFTASMLTEGGTRTRTATRLSDEVGFLGASLGAGAGQDAASLSGSSLSRHLPKLLDL
FT                   FADVAMNPAFRAKDFARVQDQRKVTLLQQRDQPATIAGKAFLKAYWGEGHPYGHYVLGD
FT                   EASVAATRPADLAGFHARFWRPANAELVVVGDVSEAELRPLLERTLGRWPAGTAAAAPR
FT                   APAPAAPHVTLLLDKPDAPQTLVMLGMPGLARASPDYVAATVAFQVLGGGMSSRLFRTL
FT                   REEKGYTYGMGAGADARRLGGVSIVHGNVKAEVTGAALGDLLGEIRKLREQPVGDAELA
FT                   DARNALVRSLPADFATVGGIAGRVAELVIHGLPDDYWNGYADAVRNVGSADVQRIAERY
FT                   LDPARATLVLVGTPAAVRPQLEGLAIGKVEVRPVPGATPVRAPPRSPRVRTQRAPATSP
FT                   AP"
     atgacgcgca gcctccgcct cctccccgtc ctcctcgccg ccgccctcgg ctgcgccggc        60
     tcgcggccgg cccccgcgcc cgcggcgccc cccgccgcgc cgccgcaggc cgccgccgcg       120
     cccgccggcg cggatcgcag ccagctcccg gccctcggcg ccgcgcccga gctgcacctc       180
     ccgcagcagc gccacttcgc gctcgcgaac gggctgcggg tgcggctggt cgagcaccgg       240
     cgcctgccca tcgtggcgct caacctggtg gtgcgcgccg gcgcggtgaa cgacccggcg       300
     cgcctgccgg gcctggcgag cttcaccgcc agcatgctca ccgagggcgg cacccgcacc       360
     cgcaccgcca cgcggctctc ggacgaggtc ggcttcctgg gcgcctcgct cggcgccggg       420
     gccggccagg acgcggcctc gctctccggc tcgtcgctct cgcggcacct cccgaagctg       480
     ctcgacctgt tcgccgacgt ggccatgaac ccggcgttcc gcgcgaagga cttcgcgcgc       540
     gtccaggacc agcgcaaggt gacgctgctc cagcagcggg accagccggc caccatcgcg       600
     ggcaaggcgt tcctgaaggc gtactggggt gagggccacc cctacggcca ctacgtgctc       660
     ggcgacgagg cgtcggtggc ggccacccgg cccgccgacc tggccgggtt ccacgcgcgc       720
     ttctggcggc ccgccaacgc cgagctggtg gtggtgggcg acgtctcaga ggccgagctg       780
     cggccgctcc tcgagcggac gctcgggagg tggccggcgg gcaccgccgc ggcggccccc       840
     cgcgcgcccg cgccggccgc gccgcacgtc acgctgctgc tcgacaagcc ggacgcgccc       900
     cagacgctgg tgatgctggg catgcccggg ctggcgcgcg cctcgccgga ctacgtcgcg       960
     gccacggtgg cgttccaggt gctgggcggc ggcatgtcgt cgcggctgtt ccgcacgctc      1020
     cgcgaggaga agggctacac ctacggcatg ggcgccggcg ccgacgcgcg ccgcctgggc      1080
     ggcgtgagca tcgtgcacgg caacgtgaag gccgaggtga ccggcgccgc gctgggcgac      1140
     ctcctcggcg agatccgcaa gctgcgcgag cagccggtcg gcgacgcgga gctggccgac      1200
     gcgcggaacg cgctcgtccg ctcgctcccg gccgacttcg ccaccgtggg cggcatcgcc      1260
     ggccgcgtcg ccgagctcgt gatccacggc ctccccgacg actactggaa cggctacgcc      1320
     gacgcggtcc ggaacgtcgg ctcggccgac gtgcagcgga tcgccgagcg ctacctcgac      1380
     cccgcgcgcg ccacgctggt gctggtgggc acgccggccg cggtccggcc gcagctcgag      1440
     gggctcgcca tcggcaaggt cgaggtccgg ccggtgcccg gcgccacgcc ggtgcgcgcg      1500
     ccgccgcgga gcccgcgggt gcgcacgcag cgggcgcctg ccacgtcgcc cgcgccctag      1560
//

If you have problems or comments...

PBIL Back to PBIL home page