(data stored in ACNUC7421 zone)

EMBL: CP000251.PE103

CP000251.PE103       Location/Qualifiers
FT   CDS_pept        125813..126742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79881"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79881.1"
FT                   /translation="MADLQNEFSWSKSRHEKFAECRRAYFYAYYGSWGGWEAAHGTPVR
FT                   ELYVLKKLSSRWQWAGSVVHGALKQMLSAARVSGTFWPAEKLLDRTRRKARAEWAASRD
FT                   KSYWREASRITGLVEHEYGEPVSDADWKRLFEQVVDGGLRGFYASEALEAIRATPRDRW
FT                   LSVDELDAWDFEGTKIWVAVDFAYRDAEGRVQILDWKTGRERTVDHTQLGIYSLYAQRK
FT                   WGAAPDAVVGGLVYLAAPEDGGAGRVSVAVDPAALATCQDQMRGSIAAMRAALADPARN
FT                   VAVEDAFPRPDDRVACRRCPFRRPCGRL"
     atggccgatc tgcagaacga gttctcctgg tcgaagtcgc gccacgagaa gttcgccgag        60
     tgccggcgcg cgtacttcta cgcctactac gggagctggg gcggctggga ggccgcgcac       120
     ggcaccccgg tgcgcgagct gtacgtcctg aagaagctct cctcccgctg gcagtgggcg       180
     ggctcggtgg tgcacggcgc gctgaagcag atgctctcgg cggcgcgggt gagcgggacg       240
     ttctggccgg cggagaagct gctcgaccgc acccgccgca aggcgcgcgc cgagtgggcc       300
     gcctcgcgcg acaagtccta ctggcgcgag gcctcgcgca tcaccggcct ggtcgagcac       360
     gagtacggcg agccggtctc cgacgcggac tggaagcggc tgttcgagca ggtggtggac       420
     ggcgggctcc gcggcttcta cgcgagcgag gcgctcgagg cgatccgcgc cacgccgcgc       480
     gaccgctggc tgtcggtgga cgagctcgac gcctgggact tcgagggcac gaagatctgg       540
     gtggcggtgg acttcgccta ccgcgacgcc gagggccggg tccagatcct cgactggaag       600
     accggccgcg agcggacggt ggaccacacc cagctcggca tctactcgct ctacgcgcag       660
     cggaagtggg gcgccgcgcc ggacgcggtg gtgggcgggc tcgtctacct ggccgcgccg       720
     gaggacggcg gcgccggccg cgtctcggtg gcggtggatc cggccgcgct cgcgacctgc       780
     caggaccaga tgcggggctc catcgccgcc atgcgcgcgg cgctcgccga cccggcccgc       840
     aacgtggcgg tggaggacgc gttcccgcgg cccgacgacc gggtcgcctg ccgccgctgc       900
     ccgttccgcc gcccctgcgg gcggctctag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page