(data stored in ACNUC7421 zone)

EMBL: CP000251.PE108

CP000251.PE108       Location/Qualifiers
FT   CDS_pept        complement(131152..132867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79886"
FT                   /db_xref="GOA:Q2IM56"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79886.1"
FT                   /translation="MHTRTTPMRATLLAIALLLSTAARAEEAKPAPKLPADAESCLMCH
FT                   DKGGGAPEVDFKAFPGSVHGQAEVGCTDCHAGYKEGPHEGELPALSAAEQATVARLAKG
FT                   AWGEGEAKHGVTAPRAYLACQSCHTTEAEAFAKSVHGKWLAQDTKAPGATCASCHGSPH
FT                   ALPAKLAEYAPKDGKRVPVPADRREMTKRCEACHGNEAFAEAAGLDPEAVITYHDSIHG
FT                   RLTRVGNAAAPTCVSCHAAAPDAGGTHAILSKTDPASTVSAANKKQACARCHAGATDTF
FT                   AGLVAHKPLHETGGSVIPHLVHVAFSWLTTLTLLFFAFHVLVDFVYELRSRLAKKAGHG
FT                   PSADAVRSVIRFDIHQRIQHWFMLSGVILLGITGWPLRGAGDAEAATYSRAFMKVFGGA
FT                   EGAATWHRVGAVLIIISAAYHLFYLTFLASKKRLPLSMLPVPKDALDMRDNILFMMGVK
FT                   KERPKFDRYMYLEKFDYWAVFWGIVMMVGTGFIFWFPVWFASWAPGWLITAAQIIHGEE
FT                   ATLAILFLFTVHFYNVHLKPSIFPMNWAWLNGRISVEAMKHEHPLEYDRLKDDL"
     ttgcacacgc ggaccacgcc tatgcgagcc accctccttg ccattgccct cctcctctcg        60
     accgccgccc gcgccgagga ggcgaagccc gccccgaagc tgccggccga cgccgagtcc       120
     tgcctcatgt gccacgacaa gggcggcggc gcgcccgagg tggacttcaa ggccttcccc       180
     ggctcggtcc acggccaggc cgaggtgggc tgcaccgact gccacgccgg ctacaaggag       240
     ggcccgcacg agggcgagct gcccgcgctc tccgccgccg agcaggccac cgtggcgcgc       300
     ctggcgaagg gcgcctgggg cgagggcgag gcgaagcacg gcgtgaccgc gccgcgcgcc       360
     tacctcgcct gccagagctg ccacacgacc gaggccgagg cgttcgcgaa gtcggtgcac       420
     ggcaagtggc tcgcgcagga caccaaggcg ccgggcgcga cctgcgcctc ctgccacggc       480
     tccccgcacg cgctcccggc gaagctcgcc gagtacgcgc cgaaggacgg caagcgcgtg       540
     ccggtgccgg ccgaccgccg cgagatgacg aagcgctgcg aggcctgcca cgggaacgag       600
     gcgttcgccg aggccgccgg gctcgacccc gaggcggtca tcacctacca cgactcgatc       660
     cacggccggc tgacgcgggt gggcaacgcg gcggcgccga cctgcgtgag ctgccacgcg       720
     gccgcgcccg acgcgggcgg cacgcacgcc atcctgtcga agaccgatcc cgcgtccacg       780
     gtgagcgcgg cgaacaagaa gcaggcctgc gcccgctgcc acgccggcgc gaccgacacg       840
     ttcgccggcc tggtggcgca caagccgctg cacgagaccg gcgggagcgt catcccgcac       900
     ctcgtccacg tggcgttctc ctggctcacc acgctgacgc tgctgttctt cgcgttccac       960
     gtgctggtgg acttcgtcta cgagctgcgc agccggctcg cgaagaaggc cggccacggc      1020
     ccgagcgcgg acgcggtccg ctcggtcatc cgcttcgaca tccaccagcg catccagcac      1080
     tggttcatgc tctcgggcgt catcctgctc ggcatcaccg gctggccgct gcgcggcgcc      1140
     ggcgacgccg aggcggccac ctactcgcgc gcgttcatga aggtgttcgg cggcgccgag      1200
     ggcgcggcca cctggcaccg ggtcggcgcg gtcctcatca tcatctcggc cgcctaccac      1260
     ctgttctacc tgacgttcct cgcctccaag aagcggctgc cgctgtcgat gctccccgtc      1320
     ccgaaggacg cgctcgacat gcgcgacaac atcctcttca tgatgggcgt gaagaaggag      1380
     cggccgaagt tcgaccggta catgtacctg gagaagttcg actactgggc cgtgttctgg      1440
     ggcatcgtga tgatggtcgg caccgggttc atcttctggt tcccggtctg gttcgcgagc      1500
     tgggcgccgg gctggctcat caccgccgcg cagatcatcc acggcgagga ggcgacgctc      1560
     gccatcctgt tcctcttcac ggtccacttc tacaacgtgc acctgaagcc ctcgatcttc      1620
     ccgatgaact gggcctggct gaacgggcgc atctcggtcg aggcgatgaa gcacgagcat      1680
     ccgctggagt acgaccggct gaaggacgac ctgtag                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page