(data stored in ACNUC7421 zone)

EMBL: CP000251.PE109

CP000251.PE109       Location/Qualifiers
FT   CDS_pept        complement(133102..133410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79887"
FT                   /db_xref="GOA:Q2IM55"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79887.1"
FT                   /translation="MAQNKLPSLIGAGIGLALFLAVALLPALLYGGYAGLLLAGGIVGT
FT                   PVQPTLLVRGLIVFGMGLGVVGVASLFAVAGAAAGAAVGAILTIAGRRPVAQEQSGR"
     atggcccaga acaagctccc ctccctcatc ggcgccggca tcggcctcgc gctgttcctc        60
     gccgtcgcgc tcctcccggc gctgctctac ggcggctacg ccggcctgct gctggcgggc       120
     gggatcgtcg gcacgccggt gcagcccacc ctgctcgtcc gcggcctcat cgtgttcggc       180
     atgggcctcg gcgtggtggg cgtcgcctcg ctgttcgcgg tggccggcgc ggccgccggc       240
     gcggcggtgg gcgcgatcct gaccatcgcc gggcgccgcc cggtcgcgca ggagcagtcg       300
     ggccgctga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page