(data stored in ACNUC7421 zone)

EMBL: CP000251.PE11

CP000251.PE11        Location/Qualifiers
FT   CDS_pept        complement(13670..14653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0011"
FT                   /product="SSU ribosomal protein S6P modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79789"
FT                   /db_xref="GOA:Q2ILV5"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79789.1"
FT                   /translation="MPPGKKTARAKRAAARPRPEGGLGVAILSRNPRLYSTRRLIEAAT
FT                   ALGHAPRVLDTLRCNMVLARDRPRIFYLGEEVLATDVHVVIPRIGASITGYGVAVVNQF
FT                   DLMGVPVLAAATPIGRSRDKLRALQLLSRFGIDIPRTVMCRYREEVPEAVQMVGGLPCI
FT                   IKLIQGSQGVGVMIANTELEVRGLLDTLWTLGQEILLQELVAESKGRDVRALVVGDRVV
FT                   AAMRRTARAGEFRSNIHRGGVAESLELGREYAETAVKAARVMGLEVAGVDMLEARTGPK
FT                   IMEVNSSPGFEGLEAATGLDIAALYVRHAVEFASARQSGYASGHLA"
     atgccccctg gcaagaagac cgcccgcgcg aagcgcgccg ccgcccgccc gcgcccggaa        60
     ggcgggctcg gcgtcgccat cctgtcgcgc aacccgcggc tctactccac ccgccgcctg       120
     atcgaggcgg cgaccgccct cggccacgcc ccgcgcgtgc tcgacaccct gcgctgcaac       180
     atggtgctgg cgcgcgaccg gccgcggatc ttctacctgg gcgaggaggt cctcgcgacc       240
     gacgtccacg tggtcatccc ccggatcggc gcctccatca ccggctacgg cgtcgcggtg       300
     gtgaaccagt tcgacctgat gggcgtcccg gtgctggccg ccgccacgcc catcggccgc       360
     tcgcgcgaca agctgcgcgc cctgcagctc ctctcccgct tcggcatcga catcccgcgc       420
     acggtgatgt gccgctaccg cgaggaggtg ccggaggcgg tgcagatggt gggcgggctg       480
     ccctgcatca tcaagctcat ccaggggagc cagggcgtgg gcgtgatgat cgccaacacc       540
     gagctggagg tgcgcgggct gctcgacacg ctctggaccc tcggccagga gatcctgctg       600
     caggagctgg tggccgagtc gaagggccgg gacgtccgcg cgctggtggt cggcgaccgg       660
     gtggtggcgg ccatgcggcg caccgcgcgc gccggcgagt tccgctccaa catccaccgc       720
     ggcggggtgg ccgagtcgct cgagctcggg cgcgagtacg cggagaccgc ggtgaaggcg       780
     gcccgggtca tggggctcga ggtggcgggc gtggacatgc tcgaggcccg caccggcccg       840
     aagatcatgg aggtcaacag ctcgccgggc ttcgaggggc tggaggcggc caccgggctc       900
     gacatcgcgg ccctgtacgt gcggcacgcg gtggagttcg cgagcgcgcg gcagtcgggg       960
     tacgcgagcg gccacctcgc ctga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page