(data stored in ACNUC7421 zone)

EMBL: CP000251.PE114

CP000251.PE114       Location/Qualifiers
FT   CDS_pept        139800..141566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0115"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79892"
FT                   /db_xref="GOA:Q2IM57"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79892.1"
FT                   /translation="MPGPLAIPDLRAPCPGCGHLAEPAGGPLNFCPRCGLDLRETARRA
FT                   PPPDPLVGRVIADRYRLVSLLGEGGMGAVYRAEHVQMGKALAVKVLRGDFARDPSAAER
FT                   FRAEARIVSRLSHPHTIAVFDFGELPERGFYLAMEYVPGQDLARALREGGAFSEARAVG
FT                   VAQQVLGSLAEAHEAGVVHRDMKPANVMLMQARPGEDFAKVLDFGIAKLRDEAGGATTG
FT                   AGAVVGTPSCLAPEQARGGPVDARADLYAMGCLLYELVSGRPPFTAASPVAVITAHLHD
FT                   PPPPLRQVAPGVSPRLAEVVHRALRKDPAERFPSADAMRAALAGPGHPARPSRRPALPR
FT                   AAGELELASREDFRDGLEQGALERQVGVLRPQRLVTPAGAALVAAVALAAGAAWRWDDL
FT                   YAALADRAPGIAARVPAALRPAAAAWVEREPNDGAAEATPLPLLPRADGVPAAEVRGAV
FT                   GAPRRPDEGDLDVYRLAVPDGAGRRVLRARWHAAGAAPDQGIPGLAVTLSLNRAPAGAE
FT                   RAPLVAAAGEGGPGAAEALSAEVEPGTYWLSVRERHAAGAAPAGRPDAPYALEVELAPP
FT                   APGEAATRAPQK"
     atgcccggcc ccctggcgat ccccgacctc cgcgccccgt gccccggctg cggacacctc        60
     gcggagccgg ccggcgggcc gctgaacttc tgcccgcgct gcggcctcga cctgcgcgag       120
     acggcgcgcc gcgcgccgcc gccggacccg ctggtgggcc gggtgatcgc ggaccgctac       180
     cggctcgtct ccctgctcgg cgagggcggc atgggcgcgg tctaccgggc cgagcacgtg       240
     cagatgggca aggcgctcgc ggtgaaggtg ctgcggggcg acttcgcccg cgacccgtcc       300
     gccgcggagc gcttccgcgc cgaggcgcgc atcgtgtcgc gcctctcgca cccgcacacc       360
     atcgcggtct tcgacttcgg cgagctgccc gagcgcggct tctacctcgc catggagtac       420
     gtgcccgggc aggacctggc gcgcgcgctg cgcgagggcg gcgcgttctc cgaggcgcgg       480
     gcggtcggcg tcgctcagca ggtgctcggg tcgctggccg aggcgcacga ggcgggcgtg       540
     gtccaccgcg acatgaagcc cgcgaacgtg atgctgatgc aggcgcggcc gggcgaggac       600
     ttcgcgaagg tgctcgactt cgggatcgcg aagctgcgcg acgaggcggg cggcgccacc       660
     accggcgcgg gcgcggtggt gggcacgccg agctgcctcg cgccggagca ggcccgcggc       720
     ggcccggtgg acgcgcgcgc cgacctctac gccatgggct gcctgctgta cgagctcgtg       780
     tccgggcggc cgccgttcac cgcggcgagc ccggtggcgg tgatcaccgc gcacctccac       840
     gatccgccgc cgccgctccg gcaggtcgcc ccgggcgtct cgccgcgcct cgccgaggtg       900
     gtccaccgcg cgctccgcaa ggatcccgcc gagcggttcc cgagcgcgga cgcgatgcgc       960
     gccgcgctcg ccgggcccgg gcacccggcc cgcccgtccc gccgccccgc gctcccccgg      1020
     gccgcgggcg agctcgagct ggcgagccgg gaggacttcc gcgacggcct ggagcagggc      1080
     gcgctggagc ggcaggtggg cgtgctgcgc ccgcagcggc tcgtcacgcc cgccggggcc      1140
     gcgctggtgg cggccgtcgc gctcgccgcc ggggccgcct ggcgctggga cgacctgtac      1200
     gcggcgctcg ccgaccgcgc gcccgggatc gcggcgcggg tgccggcggc gctccgcccg      1260
     gccgcggccg cctgggtgga gcgcgagccg aacgacggcg cggcggaggc gacgccgctc      1320
     ccgctgctcc cgcgcgcgga cggcgtgccc gccgcggagg tgcgcggcgc cgtcggcgcg      1380
     ccgcgccggc cggacgaggg cgacctcgac gtgtaccgcc tggccgtgcc ggacggcgcg      1440
     ggccggcggg tgctgcgggc gcgctggcac gcggcggggg ccgcgccgga ccagggcatc      1500
     ccggggctcg cggtgacgct ctcgctcaac cgggcgccgg ccggggccga gcgggcgccg      1560
     ctcgtggccg ccgccggcga gggcgggccg ggcgcggccg aggcgctctc ggccgaggtc      1620
     gagccgggca cctactggct gtcggtgcgc gagcggcacg cggcgggcgc cgcgccggcc      1680
     gggcggccgg acgcgcccta cgcgctcgag gtggagctcg cgccgccggc gccgggcgag      1740
     gccgcgacgc gcgcaccgca aaaatga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page