(data stored in ACNUC7421 zone)

EMBL: CP000251.PE115

CP000251.PE115       Location/Qualifiers
FT   CDS_pept        complement(141618..142067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0116"
FT                   /product="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79893"
FT                   /db_xref="GOA:Q2IM65"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79893.1"
FT                   /translation="MKLILREDVENLGKGGDLVDVKPGYGRNYLLPRGLAVSANPKNVK
FT                   ELEHQKAVAAAKAAKLKASAQAVAKRLSETPVTLKRKVGEQDKLYGSVTALDVAEALAA
FT                   RGVQLDRRSIVLDEPIKTLGEFEVPVKLHSEVAGKVKVTVEAEAE"
     atgaagctca tcctccgtga agacgtcgag aatctcggaa agggcggcga cctggtggac        60
     gtgaagcccg gctacgggcg gaactacctc ctgccgcgcg ggctcgcggt ctccgcgaat       120
     ccgaagaacg tgaaggagct cgagcaccag aaggcggtcg ccgccgccaa ggccgcgaag       180
     ctgaaggcct cggcccaggc ggtcgccaag cggctcagcg agaccccggt cacgctgaag       240
     cgcaaggtgg gcgagcagga caagctctac ggctcggtca ccgcgctgga cgtggccgag       300
     gcgctcgccg cccgcggcgt gcagctcgac cgccgctcca tcgtcctcga cgagcccatc       360
     aagaccctgg gcgagttcga ggtgccggtg aagctgcact ccgaggtggc cggcaaggtc       420
     aaggtcaccg tggaggccga ggcggagtag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page