(data stored in ACNUC7421 zone)

EMBL: CP000251.PE119

CP000251.PE119       Location/Qualifiers
FT   CDS_pept        complement(143631..144353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0120"
FT                   /product="LSU ribosomal protein L25P"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79897"
FT                   /db_xref="GOA:Q2IM61"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79897.1"
FT                   /translation="MAENVLSAQKRTEQGKGPARRLRQQGLIPAVVYGGKREPTHVALD
FT                   PATLLKAIETPHKFNTLLELQVEGASKHVLFKDYTVDPVTRKLLHADFLEVSMDQPVKV
FT                   NVPVVTVGRAAGVAEGGILSVAAHAIVVEALPNKIPVRIEVDVTELKIGRSLHVSELKA
FT                   PEGCKFKFQTDYVVVFVAVPEKEEVAAPVAAAVPGAAPAEGAAPAAGAAAPAAGAAPAA
FT                   GAAPAKGGEAKGGDKGKK"
     atggcagaga acgtcctcag cgcccagaag cgcaccgagc agggcaaggg tcccgcccgc        60
     cggcttcgcc agcagggcct catccccgcg gtcgtctacg gcggcaagcg ggagcccacc       120
     cacgtcgcgc tcgacccggc cacgctgctg aaggccatcg agacgcccca caagttcaac       180
     acgctgctcg agctgcaggt ggaaggcgcc tcgaagcacg tgctgttcaa ggactacacc       240
     gtcgatccgg tcacccggaa gctgctgcac gcggacttcc tcgaggtgag catggaccag       300
     ccggtgaagg tgaacgtccc ggtggtcacc gtcggccgcg ccgccggcgt ggccgagggc       360
     ggcatcctct cggtcgccgc gcacgccatc gtggtcgagg cgctgccgaa caagatcccg       420
     gtgcgcatcg aggtggacgt caccgagctg aagatcggcc ggtcgctcca cgtctcggag       480
     ctgaaggcgc ccgagggctg caagttcaag ttccagacgg actacgtggt cgtcttcgtc       540
     gcggtgcccg agaaggagga ggtcgcggcg ccggtcgctg cggcggtccc gggcgcggct       600
     cctgccgagg gcgcggctcc ggccgcgggc gctgcggctc cggccgccgg cgcggccccg       660
     gccgcgggcg ctgcccctgc caagggcggc gaggccaagg gcggcgacaa gggcaagaag       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page