(data stored in ACNUC7421 zone)

EMBL: CP000251.PE122

CP000251.PE122       Location/Qualifiers
FT   CDS_pept        complement(145987..146928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0123"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79900"
FT                   /db_xref="GOA:Q2IM67"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2IM67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79900.1"
FT                   /translation="MRLVTLAPAKVNLVLRVGPVRADGYHDLRTLMVPLDLGDRVDVRV
FT                   SARRGPVRCTVPGRPELHGPENLAARAAEAFRRRFGVDRAVSIRIEKRTPVTAGLGGGS
FT                   SDAAAVLRCLARAFRVRDRAALAALALEIGSDVPFFLGPGPAWAAGRGERLSPADVPPL
FT                   DLVLVYPADPSLAIRAGDAYRWLDEARAGGPQAPRRLGRPGRWRPSLLGNDLQAPCVAR
FT                   KPALQALLGLLVGAGATAAIMSGSGPTVFGVFPGRGAARGAALAIQGRAKGGAAGVQVL
FT                   LARTVRRHPRVSPWRSPRSASSPSTRRSSRPT"
     gtgcgcctcg tcacgctcgc cccggccaag gtgaacctcg tgctgcgcgt gggccccgtc        60
     cgcgcggacg ggtaccacga cctgcgcacg ctcatggtcc cgctcgatct cggcgatcgc       120
     gtggacgtgc gcgtctccgc gcgccgcggc ccggtccgct gcacggtgcc gggccggccc       180
     gagcttcacg gtccggagaa cctggcggcg cgcgcggcgg aggcgttccg gcggcgcttc       240
     ggcgtcgatc gcgcggtgtc gatccggatc gagaagcgga cgccggtgac cgccgggctg       300
     ggcgggggct cgtcggacgc ggcggcggtg ctccgctgcc tcgcccgcgc gttccgcgtg       360
     cgcgaccgcg ccgcgctcgc cgcgctcgcg ctcgagatcg gctcggacgt gccgttcttc       420
     ctcgggccgg ggccggcctg ggcggccggg cgcggcgagc ggctctcccc cgccgacgtg       480
     ccgccgctcg acctcgtgct cgtgtacccg gcggatccgt cgctcgcgat ccgggccggc       540
     gacgcctacc gctggctcga cgaggcgcgc gccggcgggc cgcaggcccc ccgccgtctg       600
     ggccgtccgg ggcggtggcg gccgtccctg ctggggaacg atctccaggc gccctgcgtg       660
     gcacgcaagc ccgcgctcca ggcgctgctt gggctgcttg tgggggcggg ggcgacggcc       720
     gctataatgt ccggcagcgg gccgacggtc ttcggagtct tcccgggccg aggcgcggcg       780
     cgcggggcgg cgttagcgat ccagggcagg gcgaaggggg gcgcggcggg cgtgcaggtc       840
     ctcctcgcgc ggacggtgcg acggcatccg agggtatcgc catggagatc accgaggtcc       900
     gcgtcttccc cgtcaacgag gagaagctca aggcctacgt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page