(data stored in ACNUC7421 zone)

EMBL: CP000251.PE123

CP000251.PE123       Location/Qualifiers
FT   CDS_pept        147078..147431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79901"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79901.1"
FT                   /translation="MNSTFARAAACAALLAAAGCRSAFAPEPVLKLSSAPAAEHPATVV
FT                   QAAELRSGPDGLAKVLGTVAAGTTVTASDKPIRGFLRVRTADGKSGYVPQAAVSATAAA
FT                   SAPAPAPAGAVAP"
     atgaactcga cgttcgcccg cgcggcggct tgcgccgcgc tgctcgccgc ggccggttgc        60
     cgcagcgcct tcgctcccga gcccgtgctc aagctctcct cggcgcccgc cgccgagcac       120
     cccgcgaccg tcgtccaggc cgccgagctc cgctccggtc cggacgggct cgccaaggtc       180
     ctcgggaccg tggcggccgg caccacggtg accgcgtccg acaagccgat ccgcggcttc       240
     ctgcgcgtgc gcaccgccga cggcaagtcc ggctacgtgc cgcaggcggc ggtgtccgcg       300
     accgccgcgg ccagcgcgcc ggccccggcg cccgccggcg ccgtcgcgcc gtag             354
//

If you have problems or comments...

PBIL Back to PBIL home page