(data stored in ACNUC7421 zone)

EMBL: CP000251.PE129

CP000251.PE129       Location/Qualifiers
FT   CDS_pept        153142..153669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79907"
FT                   /db_xref="GOA:Q2IM78"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79907.1"
FT                   /translation="MTEPRRYERIDVELPCRLYIPGERGLKFEAHCTSRNLGLGGVFLS
FT                   SSFLLREGLELFVELGLPGGPLAIRARVAHTVPGDDPELEAGFGVEFLDVDAAGRETLL
FT                   RYFTPLRYHEFYRAFAGEFPHLRERVPVADVALLLNLWEEWKVRGEGGPAFTASGAPPA
FT                   PARAGAARRARR"
     gtgaccgagc cacgccgcta cgagcgcatc gacgtcgagc ttccctgccg cctgtacatc        60
     cccggcgagc gcggcctcaa gttcgaggcc cactgcacct cgcgcaacct cgggctgggc       120
     ggcgtgttcc tctcctcctc gttcctgctg cgcgaggggc tggagctgtt cgtcgagctg       180
     gggctgccgg gcggcccgct cgcgatccgc gcccgggtgg cgcacacggt gccgggcgac       240
     gacccggagc tcgaggccgg cttcggcgtc gagttcctgg acgtggacgc ggccgggcgc       300
     gagaccttgc tccgctactt caccccgctc cgctaccacg agttctaccg cgcgttcgcc       360
     ggggagttcc cgcacctgcg cgagcgcgtg ccggtggccg acgtggccct gctcctcaac       420
     ctctgggagg agtggaaggt ccggggcgag ggaggcccgg ccttcacggc gtcgggcgcg       480
     ccgccggcgc cggcgagggc cggcgccgca cgccgcgccc gacgctag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page