(data stored in ACNUC7421 zone)

EMBL: CP000251.PE131

CP000251.PE131       Location/Qualifiers
FT   CDS_pept        156086..156955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0132"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79909"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79909.1"
FT                   /translation="MADDPTRVRTPEERAAAAAGHCLVFVAGDGALGLRVPLDGEVVLG
FT                   RDPSCAVSLPAGDVSRRHARVVPDGEGHLVLDLGSTNGTWVNGREVAVHRLAPGDRVQV
FT                   GPFVARYLRAGDAEESELAALADLALRDPLTGLPNRRAFEESLRREVARARRGGARLAV
FT                   AVLDVDRFKDVNDRHGHAAGDVALAEVARRAAAALRAGDLLARIGGEELAAILPGADVA
FT                   AAAEVAERVRRAVGTEPVQAGGQALRVTVSLGCAELAPGDADGADVFARADGHLYRAKN
FT                   AGRDRVAW"
     atggccgacg atcccacccg cgtccggacc ccggaggagc gcgccgccgc cgcggccggc        60
     cactgcctcg tgttcgtggc cggggacggc gcgctcggcc tgcgcgtgcc gctcgacggc       120
     gaggtggtgc tcgggcgcga tccgtcctgc gcggtgtcgc tgcccgcggg cgacgtctcg       180
     cgccggcacg cccgcgtggt gccggacggc gagggccacc tggtgctgga cctcggctcg       240
     accaacggga cctgggtgaa cgggcgcgag gtggcggtgc accggctcgc cccgggcgac       300
     cgggtgcagg tcggcccgtt cgtggcgcgg tacctgcgcg ccggcgacgc cgaggagtcg       360
     gagctcgccg ccctcgcgga cctggcgctg cgcgatccgc tcaccgggct gcccaaccgc       420
     cgcgccttcg aggagtcgct ccgccgcgag gtggcgcggg cgcggcgcgg cggcgcccgg       480
     ctcgccgtgg cggtgctcga cgtggatcgc ttcaaggacg tcaacgaccg gcacggccac       540
     gccgccggcg acgtcgcgct cgccgaggtg gcgcgccgcg ccgcggccgc gctgcgggcc       600
     ggcgatctcc tggcgcgcat cggcggcgag gagctcgccg ccatcctccc cggcgccgat       660
     gtggccgccg ccgccgaggt ggccgagcgg gtccgccggg cggtgggcac cgagccggtg       720
     caggcgggcg ggcaggcgct gcgcgtgacc gtgtcgctcg gctgcgccga gctcgcgccc       780
     ggcgacgccg acggcgccga cgtgttcgcg cgcgccgacg gccacctgta ccgcgccaag       840
     aacgcgggac gcgatcgcgt ggcgtggtag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page