(data stored in ACNUC7421 zone)

EMBL: CP000251.PE136

CP000251.PE136       Location/Qualifiers
FT   CDS_pept        complement(161162..162403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79914"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79914.1"
FT                   /translation="MSLPLRRAAVLLLAAACTPSTAPAPAPAAPPANHVARGTITPARY
FT                   VPPPARGARVRPEACLPGEPFAAPSALAEEAVAALDAGARERALACADEALRLSPRMVP
FT                   ALTARGAALAALDRLDEARLAFARALAVDPDEPEALLGAAELHVRRLGSARDALEAGLE
FT                   YAVRGVRSATRPPRKDKDLAARLELVAGMAENDLGRSHLALAHLERALAVRPKDPDALY
FT                   ERGVALFELCRFGDARRAFERALAIAPDDPWAIHQLGLVAERTGEGRRAAALLARARSL
FT                   APDDFKDELAVDAGAFRAEVEAAVAALPAAEREALKLAPVEIQDLPDTEDLTAVEPPLS
FT                   PSILGLYRGPPADEACTEADGPRCRSIVFYRKNLLRFARDRAELTEQVRVTLLHELGHL
FT                   HGESDDELRDRGLE"
     atgtctctgc cgctccgccg tgcggcggtc ctcctgctcg ctgcggcctg caccccgtcc        60
     accgctcccg cgcccgcccc ggcggcgccg ccggcgaacc acgtcgcgcg cgggacgatc       120
     acgcccgccc gctacgtccc gccgcccgcc cgcggggccc gggtccgccc ggaggcgtgc       180
     ctgccgggcg agccgttcgc ggcgccgagc gcgctcgccg aggaggcggt cgcggcgctg       240
     gacgcgggcg cccgcgagcg cgcgctggcc tgcgccgacg aggcgctgcg gctctcgccg       300
     cggatggtgc cggcgctcac cgcgcgcggg gcggcgctcg ccgcgctcga ccggctcgac       360
     gaggcgcggc tcgccttcgc ccgcgcgctg gcggtggatc cggacgagcc cgaggcgctg       420
     ctcggcgcgg ccgagctgca cgtccgccgg ctgggctccg cccgcgacgc gctggaggcc       480
     ggcctcgagt acgcggtgcg cggcgtgcgc agcgccaccc gtccgccgcg caaggacaag       540
     gacctcgcgg cccggctcga gctggtggcc gggatggccg agaacgacct cggccgcagc       600
     cacctggcgc tcgcccacct cgagcgcgcg ctcgcggtcc ggccgaagga cccggacgcg       660
     ctctacgagc gcggggtggc gctgttcgag ctgtgccgct tcggcgacgc gcggcgcgcg       720
     ttcgagcggg cgctcgcgat cgcgcccgac gacccgtggg ccatccacca gctcgggctg       780
     gtcgccgagc gcaccgggga gggccggcgc gcggcggcgc tcctggcgcg ggcccggtcg       840
     ctcgcgccgg acgacttcaa ggacgagctg gccgtggacg cgggcgcgtt ccgggccgag       900
     gtggaggccg cggtggcggc gctccccgcg gccgagcgcg aggcgctgaa gctcgcgccg       960
     gtggagatcc aggacctgcc cgacaccgag gacctcaccg cggtcgagcc gccgctctcg      1020
     ccgtcgatcc tcgggctcta ccgcggcccg cccgcggacg aggcctgcac cgaggccgac      1080
     gggccccgct gccggagcat cgtgttctac cgcaagaacc tgctccgctt cgcccgcgac      1140
     cgggccgagc tcaccgagca ggtgcgcgtg acgctcctgc acgagctcgg gcacctgcac      1200
     ggcgagtcgg acgacgagct gcgcgaccgc ggcctcgagt ag                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page