(data stored in ACNUC7421 zone)

EMBL: CP000251.PE143

CP000251.PE143       Location/Qualifiers
FT   CDS_pept        complement(168414..168794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0144"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79921"
FT                   /db_xref="GOA:Q2IM90"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79921.1"
FT                   /translation="MTPGQYILVVDDDDDFREALSEVLVDAGYPVQQAENGEVALAKVD
FT                   EEAPGIVLLDLKMPVLDGWGVMERMRGDAKSAAVPILILSAYGFEWEAELLGAQGYIPK
FT                   SVGMDEILERVRKAAGPPPMRH"
     atgaccccgg gccagtacat cctggtggtg gacgacgacg acgacttccg cgaggcgctc        60
     tcggaggtgc tggtggacgc cggctacccg gtgcagcagg ccgagaacgg cgaggtggcg       120
     ctcgccaagg tggacgagga ggcgccgggc atcgtcctgc tcgacctcaa gatgccggtg       180
     ctcgacggct ggggcgtgat ggagcggatg cgcggggacg cgaagagcgc cgccgtgccc       240
     atcctgatcc tctccgcgta cggcttcgag tgggaggcgg agctgctcgg cgcccagggc       300
     tacatcccga agtcggtggg gatggacgag atcctggagc gcgtccgcaa ggccgccggg       360
     cccccgccca tgcggcactg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page